PDB entry 5cyg

View 5cyg on RCSB PDB site
Description: Crystal Structure of isoform 2 of uridine phosphorylase from Schistosoma mansoni APO form
Class: transferase
Keywords: transferase
Deposited on 2015-07-30, released 2016-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082420
    Database cross-references and differences (RAF-indexed):
    • Uniprot G4VGH9 (Start-295)
      • conflict (242)
    Domains in SCOPe 2.06: d5cyga_
  • Chain 'B':
    Compound: Putative uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082420
    Database cross-references and differences (RAF-indexed):
    • Uniprot G4VGH9
      • conflict (242)
    Domains in SCOPe 2.06: d5cygb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cygA (A:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgigipstlilmhevtkllyyagckdvlfi
    rlgtsdglgvkpgtivlsdrcvntklepynelcilgkpvrrqtkvdsnavnelkklsenl
    slkcsvvvggtitandfyeelgrlngsictfskeeklaflqsvydhgirnmemegaaits
    hcyltghrailvcvtvvnrletdevttstdefklfeqlpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cygA (A:)
    qpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklagl
    alpveniagsharfvlykvdhilfadhgigipstlilmhevtkllyyagckdvlfirlgt
    sdglgvkpgtivlsdrcvntklepynelcilgkpvrrqtkvdsnavnelkklsenlsvvv
    ggtitandfyeelgrlngsictfskeeklaflqsvydhgirnmemegaaitshcyltghr
    ailvcvtvvnrletdestdefklfeqlpgqlvgeylkrnngiivr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cygB (B:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgigipstlilmhevtkllyyagckdvlfi
    rlgtsdglgvkpgtivlsdrcvntklepynelcilgkpvrrqtkvdsnavnelkklsenl
    slkcsvvvggtitandfyeelgrlngsictfskeeklaflqsvydhgirnmemegaaits
    hcyltghrailvcvtvvnrletdevttstdefklfeqlpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cygB (B:)
    ivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglal
    pveniagsharfvlykvdhilfadhgigipstlilmhevtkllyyagckdvlfirlgtsd
    glgvkpgtivlsdrcvntklepynelcilgkpvrrqtkvdsnavnelkklsenlsvvvgg
    titandfyeelgrlngsictfskeeklaflqsvydhgirnmemegaaitshcyltghrai
    lvcvtvvnrletdevdefklfeqlpgqlvgeylkrnngii