PDB entry 5cyf

View 5cyf on RCSB PDB site
Description: Crystal structure of isoform 2 of uridine phosphorylase from Schistosoma mansoni in complex with citrate
Class: transferase
Keywords: transferase
Deposited on 2015-07-30, released 2016-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082420
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cyfa_
  • Chain 'B':
    Compound: Putative uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082420
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cyfb_
  • Chain 'C':
    Compound: Putative uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082420
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cyfc_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cyfA (A:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgigipstlilmhevtkllyyagckdvlfi
    rlgtsdglgvkpgtivlsdrcvntklepynelcilgkpvrrqtkvdsnavnelkklsenl
    slkcsvvvggtitandfyeelgrlngsictfskeeklaflqsvydhgirnmemegaaits
    hcnltghrailvcvtvvnrletdevttstdefklfeqlpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cyfA (A:)
    ivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglal
    pveniagsharfvlykvdhilfadhgigipstlilmhevtkllyyagckdvlfirlgtsd
    glgvkpgtivlsdrcvntklepynelcilgkpvrrqtkvdsnavnelkklsenlslkcsv
    vvggtitandfyeelgrlngsictfskeeklaflqsvydhgirnmemegaaitshcnltg
    hrailvcvtvvnrletdevttstdefklfeqlpgqlvgeylkrnngiivr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cyfB (B:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgigipstlilmhevtkllyyagckdvlfi
    rlgtsdglgvkpgtivlsdrcvntklepynelcilgkpvrrqtkvdsnavnelkklsenl
    slkcsvvvggtitandfyeelgrlngsictfskeeklaflqsvydhgirnmemegaaits
    hcnltghrailvcvtvvnrletdevttstdefklfeqlpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cyfB (B:)
    ivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglal
    pveniagsharfvlykvdhilfadhgigipstlilmhevtkllyyagckdvlfirlgtsd
    glgvkpgtivlsdrcvntklepynelcilgkpvrrqtkvdsnavnelkklsenlslkcsv
    vvggtitandfyeelgrlngsictfskeeklaflqsvydhgirnmemegaaitshcnltg
    hrailvcvtvvnrletdevstdefklfeqlpgqlvgeylkrnngiivr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cyfC (C:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgigipstlilmhevtkllyyagckdvlfi
    rlgtsdglgvkpgtivlsdrcvntklepynelcilgkpvrrqtkvdsnavnelkklsenl
    slkcsvvvggtitandfyeelgrlngsictfskeeklaflqsvydhgirnmemegaaits
    hcnltghrailvcvtvvnrletdevttstdefklfeqlpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cyfC (C:)
    nshdvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglalpveniags
    harfvlykvdhilfadhgigipstlilmhevtkllyyagckdvlfirlgtsdglgvkpgt
    ivlsdrcvntklepynelcilgkpvrrqtkvdsnavnelkklsenlslkcsvvvggtita
    ndfyeelgrlngsictfskeeklaflqsvydhgirnmemegaaitshcnltghrailvcv
    tvvnrletdtstdefklfeqlpgqlvgeylkrnngiivr