PDB entry 5cxs

View 5cxs on RCSB PDB site
Description: Crystal Structure of Isoform 2 of Purine Nucleoside Phosphorylase complexed with MES
Class: transferase
Keywords: transferase
Deposited on 2015-07-29, released 2016-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_179110
    Database cross-references and differences (RAF-indexed):
    • Uniprot G4VP83 (13-286)
      • expression tag (4-12)
    Domains in SCOPe 2.06: d5cxsa1, d5cxsa2
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cxsA (A:)
    mttpvvanyenasmaadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpk
    ttvaghvgnlvlgsvggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlag
    ginrklksgdfvlikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkia
    qendfqdlvhegvyafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlav
    sliannsildaendvsinhekvlavaekradllqmwfkeiitrlpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cxsA (A:)
    vvanyenasmaadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpkttva
    ghvgnlvlgsvggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlagginr
    klksgdfvlikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkiaqend
    fqdlvhegvyafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlavslia
    nnsildaendvsinhekvlavaekradllqmwfkeiitrlpld