PDB entry 5cvv

View 5cvv on RCSB PDB site
Description: coniferyl alcohol bound monolignol 4-O-methyltransferase 9
Class: transferase
Keywords: monolignol-4-O methyltransferase, lignin, coniferyl alcohol, s-adenosylmethionine, TRANSFERASE
Deposited on 2015-07-27, released 2015-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385 (Start-367)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (32)
      • engineered mutation (132)
      • engineered mutation (164-165)
      • engineered mutation (168)
      • engineered mutation (174)
      • engineered mutation (318)
    Domains in SCOPe 2.06: d5cvva1, d5cvva2
  • Chain 'B':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385 (Start-367)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (32)
      • engineered mutation (132)
      • engineered mutation (164-165)
      • engineered mutation (168)
      • engineered mutation (174)
      • engineered mutation (318)
    Domains in SCOPe 2.06: d5cvvb1, d5cvvb2
  • Heterogens: SAH, N7I, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cvvA (A:)
    mgstgnaeiqiipthssdeeanlfahqlaraaslpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihmdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cvvA (A:)
    ssdeeanlfahqlaraaslpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
    apvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltknedgvslapflllat
    dkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfnkgmssnstitmkkil
    emyngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgvehlggdm
    fdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdpsiatkv
    vihmdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cvvB (B:)
    mgstgnaeiqiipthssdeeanlfahqlaraaslpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihmdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cvvB (B:)
    ssdeeanlfahqlaraaslpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
    apvmldrvlrllasysvvtytlrverlyglapvckfltknedgvslapflllatdkvlle
    pwfylkdaileggipfnkaygmniwdyfgtdhrinkvfnkgmssnstitmkkilemyngf
    eglttivdvgggtgavasmivakypsinainfdlphviqdapafsgvehlggdmfdgvpk
    gdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdpsiatkvvihmda
    lmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkta