PDB entry 5cvu

View 5cvu on RCSB PDB site
Description: sinpyl alcohol bound monolignol 4-O-methyltransferase 5
Class: transferase
Keywords: monolignol 4-O-methyltransferase, sinapyl alcohol, lignin, s-adenosylmethionine, TRANSFERASE
Deposited on 2015-07-27, released 2015-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385 (Start-367)
      • engineered mutation (132)
      • engineered mutation (164-165)
      • engineered mutation (168)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5cvua1, d5cvua2
  • Chain 'B':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385 (Start-367)
      • engineered mutation (132)
      • engineered mutation (164-165)
      • engineered mutation (168)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5cvub1, d5cvub2
  • Chain 'C':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385 (Start-367)
      • engineered mutation (132)
      • engineered mutation (164-165)
      • engineered mutation (168)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5cvuc1, d5cvuc2
  • Chain 'D':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385 (Start-367)
      • engineered mutation (132)
      • engineered mutation (164-165)
      • engineered mutation (168)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5cvud1, d5cvud2
  • Heterogens: 55B, SAH, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cvuA (A:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cvuA (A:)
    hssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnp
    eapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltknedgvslapfllla
    tdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfnkgmssnstitmkki
    lemyngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgvehlggd
    mfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdpsiatk
    vvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cvuB (B:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cvuB (B:)
    iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaq
    lpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltknedgvsla
    pflllatdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfnkgmssnst
    itmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgv
    ehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspd
    psiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cvuC (C:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cvuC (C:)
    hssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnp
    eapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltknedgvslapfllla
    tdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfnkgmssnstitmkki
    lemyngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgvehlggd
    mfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdpsiatk
    vvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cvuD (D:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cvuD (D:)
    eiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaa
    qlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltknedgvsl
    apflllatdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfnkgmssns
    titmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsg
    vehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppsp
    dpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkt
    a