PDB entry 5cub

View 5cub on RCSB PDB site
Description: Crystal structure of the bromodomain of bromodomain adjacent to zinc finger domain protein 2B (BAZ2B) in complex with 314268-40-1 (SGC - Diamond I04-1 fragment screening)
Class: transcription
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, transcription
Deposited on 2015-07-24, released 2015-09-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain adjacent to zinc finger domain protein 2B
  Species: Homo sapiens [TaxId:9606]
  Gene: BAZ2B, KIAA1476
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UIF8 (2-114)
    • expression tag (0-1)
  Domains in SCOPe 2.05: d5cuba_
• Heterogens: 54V, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5cubA (A:)
  smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
  eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk