PDB entry 5ctw

View 5ctw on RCSB PDB site
Description: Crystal structure of the ATP binding domain of S. aureus GyrB complexed with a fragment
Class: isomerase/isomerase inhibitor
Keywords: DNA gyrase, GyrB, fragment-based screening, structure-based design, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2015-07-24, released 2016-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ctwa_
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ctwb_
  • Heterogens: 55D, MG, CL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ctwA (A:)
    gsvtalsdvnntdnygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidea
    lagyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyv
    hrnetiyhqaykkgvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirel
    aflnkgiqitlrderdeenvredsyhyeggik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ctwA (A:)
    agqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdn
    wikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvp
    qfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderd
    eenvredsyhye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ctwB (B:)
    gsvtalsdvnntdnygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidea
    lagyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyv
    hrnetiyhqaykkgvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirel
    aflnkgiqitlrderdeenvredsyhyeggik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ctwB (B:)
    gqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnw
    ikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpq
    fdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderde
    envredsyhyeg