PDB entry 5ctu

View 5ctu on RCSB PDB site
Description: Crystal structure of the ATP binding domain of S. aureus GyrB complexed with a fragment
Class: isomerase
Keywords: DNA gyrase, GyrB, fragment-based screening, structure-based design, ISOMERASE
Deposited on 2015-07-24, released 2016-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ctua_
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K8 (2-End)
      • expression tag (0-1)
  • Heterogens: MPD, CL, 54X, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ctuA (A:)
    gsvtalsdvnntdnygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidea
    lagyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyv
    hrnetiyhqaykkgvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirel
    aflnkgiqitlrderdeenvredsyhyeggik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ctuA (A:)
    agqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdn
    wikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvp
    qfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderd
    eenvredsyhye
    

  • Chain 'B':
    No sequence available.