PDB entry 5cq5

View 5cq5 on RCSB PDB site
Description: Crystal structure of the bromodomain of bromodomain adjacent to zinc finger domain protein 2B (BAZ2B) in complex with 2,3-Ethylenedioxybenzoic Acid (SGC - Diamond I04-1 fragment screening)
Class: transcription
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, transcription
Deposited on 2015-07-21, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.07: d5cq5a1, d5cq5a2
  • Heterogens: EDO, 53E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cq5A (A:)
    yfqsmsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfs
    tireklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cq5A (A:)
    smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
    eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtf