PDB entry 5cq5
View 5cq5 on RCSB PDB site
Description: Crystal structure of the bromodomain of bromodomain adjacent to zinc finger domain protein 2B (BAZ2B) in complex with 2,3-Ethylenedioxybenzoic Acid (SGC - Diamond I04-1 fragment screening)
Class: transcription
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, transcription
Deposited on
2015-07-21, released
2015-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated
2015-09-09, with a file datestamp of
2015-09-04.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain adjacent to zinc finger domain protein 2B
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2B, KIAA1476
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5cq5a1, d5cq5a2 - Heterogens: EDO, 53E, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5cq5A (A:)
yfqsmsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfs
tireklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs
Sequence, based on observed residues (ATOM records): (download)
>5cq5A (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtf