PDB entry 5cpz

View 5cpz on RCSB PDB site
Description: Crystal structure of murine polyomavirus RA strain VP1 in complex with the GT1a glycan
Class: viral protein
Keywords: Murine Polyomavirus, Virus protein, carbohydrate complex, virus-host interaction, viral protein
Deposited on 2015-07-21, released 2015-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Murine polyomavirus (strain P16 small-plaque) [TaxId:47935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cpza_
  • Chain 'B':
    Compound: Capsid protein VP1
    Species: Murine polyomavirus (strain P16 small-plaque) [TaxId:47935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cpzb_
  • Chain 'C':
    Compound: Capsid protein VP1
    Species: Murine polyomavirus (strain P16 small-plaque) [TaxId:47935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cpzc_
  • Chain 'D':
    Compound: Capsid protein VP1
    Species: Murine polyomavirus (strain P16 small-plaque) [TaxId:47935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cpzd_
  • Chain 'E':
    Compound: Capsid protein VP1
    Species: Murine polyomavirus (strain P16 small-plaque) [TaxId:47935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cpze_
  • Heterogens: SO4, GOL, SIA, GAL, NGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cpzA (A:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgn
    ntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkg
    istpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpis
    kakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgpl
    ckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cpzA (A:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgn
    ntlptwsmaklqlpmlncdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgistp
    vegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpiskakl
    dkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplckge
    glylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cpzB (B:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgn
    ntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkg
    istpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpis
    kakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgpl
    ckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cpzB (B:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgn
    ntlptwsmaklqlpmlncdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgistp
    vegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpiskakl
    dkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplckge
    glylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cpzC (C:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgn
    ntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkg
    istpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpis
    kakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgpl
    ckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cpzC (C:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgn
    ntlptwsmaklqlpmlndtlqmweavsvktevvgsgslldvhgfnkptdtvntkgistpv
    egsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpiskakld
    kdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplckgeg
    lylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cpzD (D:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgn
    ntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkg
    istpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpis
    kakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgpl
    ckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5cpzE (E:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgn
    ntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkg
    istpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpis
    kakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgpl
    ckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cpzE (E:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgn
    ntlptwsmaklqlpmlndtlqmweavsvktevvgsgslldvhgfnkptdtvntkgistpv
    egsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpiskakld
    kdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplckgeg
    lylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk