PDB entry 5cpx

View 5cpx on RCSB PDB site
Description: Crystal structure of murine polyomavirus PTA strain VP1 in complex with the DSLNT glycan
Class: viral protein
Keywords: Murine Polyomavirus, Virus protein, carbohydrate complex, virus-host interaction, viral protein
Deposited on 2015-07-21, released 2015-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cpxa_
  • Chain 'B':
    Compound: vp1
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cpxb_
  • Chain 'C':
    Compound: vp1
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cpxc_
  • Chain 'D':
    Compound: vp1
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cpxd_
  • Chain 'E':
    Compound: vp1
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cpxe_
  • Heterogens: GOL, SIA, GAL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cpxA (A:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspen
    ntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkg
    istpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpis
    kakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgpl
    ckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cpxA (A:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspen
    ntlptwsmaklqlpmlntlqmweavsvktevvgsgslldvhgfnkptdtvntkgistpve
    gsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpiskakldk
    dgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplckgegl
    ylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cpxB (B:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspen
    ntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkg
    istpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpis
    kakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgpl
    ckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cpxB (B:)
    mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspenn
    tlptwsmaklqlpmlntlqmweavsvktevvgsgslldvhgfnkptdtvntkgistpveg
    sqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpiskakldkd
    gmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplckgegly
    lscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cpxC (C:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspen
    ntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkg
    istpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpis
    kakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgpl
    ckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cpxC (C:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspen
    ntlptwsmaklqlpmlntlqmweavsvktevvgsgslldvhgfnkptdtvntkgistpve
    gsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpiskakldk
    dgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplckgegl
    ylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cpxD (D:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspen
    ntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkg
    istpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpis
    kakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgpl
    ckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cpxD (D:)
    mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspenn
    tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi
    stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk
    akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc
    kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5cpxE (E:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspen
    ntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkg
    istpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpis
    kakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgpl
    ckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cpxE (E:)
    gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspen
    ntlptwsmaklqlpmlntlqmweavsvktevvgsgslldvhgfnkptdtvntkgistpve
    gsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpiskakldk
    dgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplckgegl
    ylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk