PDB entry 5cps

View 5cps on RCSB PDB site
Description: Disproportionating enzyme 1 from Arabidopsis - maltotriose soak
Class: transferase
Keywords: disproportionating enzyme 1, 4-alpha-glucanotransferase, Glycoside Hydrolase Family 77, starch degradation, transferase
Deposited on 2015-07-21, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DPE1, At5g64860, MXK3.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cpsa_
  • Chain 'B':
    Compound: 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DPE1, At5g64860, MXK3.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cpsb_
  • Heterogens: GLC, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cpsA (A:)
    mhhhhhhgkpipnpllgldstenlyfqgidpftmevvssnstclssisvgedfpseyeqw
    lpvpdpesrrragvllhptsfrgphgigdlgeeafrfidwlhstgcsvwqvlplvppdeg
    gspyagqdancgntllisldelvkdgllikdelpqpidadsvnyqtanklksplitkaak
    rlidgngelksklldfrndpsiscwledaayfaaidntlnayswfewpeplknrhlsale
    aiyesqkefidlfiakqflfqrqwqkvreyarrqgvdimgdmpiyvgyhsadvwankkhf
    llnkkgfpllvsgvppdlfsetgqlwgsplydwkamesdqyswwvnrirraqdlydecri
    dhfrgfagfwavpseakvamvgrwkvgpgkslfdaiskgvgkikiiaedlgvitkdvvel
    rksigapgmavlqfafgggadnphlphnhevnqvvysgthdndtirgwwdtldqeekska
    mkylsiageddiswsviqaafsstaqtaiipmqdilglgssarmntpatevgnwgwrips
    stsfdnletesdrlrdllslygrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cpsA (A:)
    svgedfpseyeqwlpvpdpesrrragvllhptsfrgphgigdlgeeafrfidwlhstgcs
    vwqvlplvppdeggspyagqdancgntllisldelvkdgllikdelpqpidadsvnyqta
    nklksplitkaakrlidgngelksklldfrndpsiscwledaayfaaidntlnayswfew
    peplknrhlsaleaiyesqkefidlfiakqflfqrqwqkvreyarrqgvdimgdmpiyvg
    yhsadvwankkhfllnkkgfpllvsgvppdlfsetgqlwgsplydwkamesdqyswwvnr
    irraqdlydecridhfrgfagfwavpseakvamvgrwkvgpgkslfdaiskgvgkikiia
    edlgvitkdvvelrksigapgmavlqfafgggadnphlphnhevnqvvysgthdndtirg
    wwdtldqeekskamkylsiageddiswsviqaafsstaqtaiipmqdilglgssarmntp
    atevgnwgwripsstsfdnletesdrlrdllslygrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cpsB (B:)
    mhhhhhhgkpipnpllgldstenlyfqgidpftmevvssnstclssisvgedfpseyeqw
    lpvpdpesrrragvllhptsfrgphgigdlgeeafrfidwlhstgcsvwqvlplvppdeg
    gspyagqdancgntllisldelvkdgllikdelpqpidadsvnyqtanklksplitkaak
    rlidgngelksklldfrndpsiscwledaayfaaidntlnayswfewpeplknrhlsale
    aiyesqkefidlfiakqflfqrqwqkvreyarrqgvdimgdmpiyvgyhsadvwankkhf
    llnkkgfpllvsgvppdlfsetgqlwgsplydwkamesdqyswwvnrirraqdlydecri
    dhfrgfagfwavpseakvamvgrwkvgpgkslfdaiskgvgkikiiaedlgvitkdvvel
    rksigapgmavlqfafgggadnphlphnhevnqvvysgthdndtirgwwdtldqeekska
    mkylsiageddiswsviqaafsstaqtaiipmqdilglgssarmntpatevgnwgwrips
    stsfdnletesdrlrdllslygrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cpsB (B:)
    svgedfpseyeqwlpvpdpesrrragvllhptsfrgphgigdlgeeafrfidwlhstgcs
    vwqvlplvppdeggspyagqdancgntllisldelvkdgllikdelpqpidadsvnyqta
    nklksplitkaakrlidgngelksklldfrndpsiscwledaayfaaidntlnayswfew
    peplknrhlsaleaiyesqkefidlfiakqflfqrqwqkvreyarrqgvdimgdmpiyvg
    yhsadvwankkhfllnkkgfpllvsgvpptgqlwgsplydwkamesdqyswwvnrirraq
    dlydecridhfrgfagfwavpseakvamvgrwkvgpgkslfdaiskgvgkikiiaedlgv
    itkdvvelrksigapgmavlqfafgggadnphlphnhevnqvvysgthdndtirgwwdtl
    dqeekskamkylsiageddiswsviqaafsstaqtaiipmqdilglgssarmntpatevg
    nwgwripsstsfdnletesdrlrdllslygrl