PDB entry 5cp3

View 5cp3 on RCSB PDB site
Description: Crystal Structure of an Antigen-Binding Fragment of Monoclonal Antibody against Sulfonamides in Complex with Sulfathiazole
Class: immune system
Keywords: Sulfathiazole, Anti-Sulfonamides Antibody, Antigen-Binding Fragment, Complex, IMMUNE SYSTEM
Deposited on 2015-07-21, released 2015-08-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light Chain of Antigen-Binding Fragment of Monoclonal Antibody of 4C7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5CP3 (0-217)
    Domains in SCOPe 2.05: d5cp3a1, d5cp3a2
  • Chain 'H':
    Compound: Heavy Chain of Antigen-Binding Fragment of Monoclonal Antibody of 4C7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5CP3 (0-211)
  • Heterogens: YTZ, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cp3A (A:)
    dvvmtqtpitlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
    srvpdrftgsgagtdftlkisrveaedlgiyycwqgthfpqtfgggtkleikraeaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqdskdstysm
    sstltltkdeyerhntytceathktstspivksfnrne
    

  • Chain 'H':
    No sequence available.