PDB entry 5coo

View 5coo on RCSB PDB site
Description: X-ray crystal structure of wild type HIV-1 protease in complex with GRL-085
Class: hydrolase/hydrolase inhibitor
Keywords: GRL-085, HIV-1 protease, protease-inhibitor, darunavir, Tp-THF, nonpeptidic, hydroxyl, O-methoxy., HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2015-07-20, released 2016-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0X8E3 (0-98)
      • engineered mutation (24)
    Domains in SCOPe 2.06: d5cooa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0X8E3 (0-98)
      • engineered mutation (24)
    Domains in SCOPe 2.06: d5coob_
  • Heterogens: 52Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cooA (A:)
    pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cooB (B:)
    pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf