PDB entry 5coo
View 5coo on RCSB PDB site
Description: X-ray crystal structure of wild type HIV-1 protease in complex with GRL-085
Class: hydrolase/hydrolase inhibitor
Keywords: GRL-085, HIV-1 protease, protease-inhibitor, darunavir, Tp-THF, nonpeptidic, hydroxyl, O-methoxy., HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2015-07-20, released
2016-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated
2016-01-13, with a file datestamp of
2016-01-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5cooa_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5coob_ - Heterogens: 52Z, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5cooA (A:)
pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5cooB (B:)
pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf