PDB entry 5cm8

View 5cm8 on RCSB PDB site
Description: Structural Basis for the Selectivity of Guanine Nucleotide Exchange Factors for the small G-protein Ral
Class: signaling protein
Keywords: Complex G-protein Exchange Factor, signaling protein
Deposited on 2015-07-16, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-03, with a file datestamp of 2016-01-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ral guanine nucleotide dissociation stimulator-like 2
    Species: Mus musculus [TaxId:10090]
    Gene: Rgl2, Rab2l, Rlf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61193 (Start-472)
      • conflict (105)
      • conflict (360)
  • Chain 'B':
    Compound: Ras-related protein Ral-A
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Rala, CG2849
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cm8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cm8B (B:)
    gsmskkptagpalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgee
    vqidildtagqedyaairdnyfrsgegflcvfsitddesfqatqefreqilrvkndesip
    fllvgnkcdlndkrkvplsecqlraqqwavpyvetsaktrenvdkvffdlmreirsrkte
    dskatsgrakdrckkrrlkctll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cm8B (B:)
    gpalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gqedyaairdnyfrsgegflcvfsitddesfqatqefreqilrvkndesipfllvgnknd
    krkvplsecqlraqqwavpyvetsaktrenvdkvffdlmreirsrkted