PDB entry 5cm7

View 5cm7 on RCSB PDB site
Description: Structure of thiamine-monophosphate kinase from Acinetobacter baumannii in complex with adenosine diphosphate (ADP) and thiamine diphosphate (TPP)
Class: transferase
Keywords: SSGCID, Acinetobacter baumannii, Thiamine-monophosphate kinase, thiamine diphosphate, TPP, adenosine diphosphate, ADP, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2015-07-16, released 2015-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine-monophosphate kinase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: thiL, ABUW_0092
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cm7a1, d5cm7a2
  • Chain 'B':
    Compound: Thiamine-monophosphate kinase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: thiL, ABUW_0092
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cm7b1, d5cm7b2
  • Heterogens: ADP, CA, MG, NA, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cm7A (A:)
    mahhhhhhmaefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfp
    letsphaigwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgv
    aliggdttqgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghsl
    qqrldyptprcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlq
    qieeqqrwqyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgs
    dyplqihgyqhfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cm7A (A:)
    maefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphai
    gwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdtt
    qgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldypt
    prcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrw
    qyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihg
    yqhfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cm7B (B:)
    mahhhhhhmaefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfp
    letsphaigwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgv
    aliggdttqgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghsl
    qqrldyptprcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlq
    qieeqqrwqyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgs
    dyplqihgyqhfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cm7B (B:)
    aefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphaig
    wksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdttq
    gphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptp
    rcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwq
    yalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgy
    qhfa