PDB entry 5cm0

View 5cm0 on RCSB PDB site
Description: Crystal structure of branched-chain aminotransferase from thermophilic archaea Geoglobus acetivorans
Class: transferase
Keywords: aminotransferase, branched-chain, PLP, BCAT, Geoglobus acetivorans, TRANSFERASE
Deposited on 2015-07-16, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Branched-chain transaminase
    Species: Geoglobus acetivorans [TaxId:565033]
    Gene: GACE_1900
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cm0a_
  • Chain 'B':
    Compound: Branched-chain transaminase
    Species: Geoglobus acetivorans [TaxId:565033]
    Gene: GACE_1900
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cm0b_
  • Chain 'C':
    Compound: Branched-chain transaminase
    Species: Geoglobus acetivorans [TaxId:565033]
    Gene: GACE_1900
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cm0c_
  • Heterogens: PLP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cm0A (A:)
    msellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarv
    idlkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpw
    gklygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhn
    gyisegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysa
    deifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cm0A (A:)
    ellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvid
    lkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwek
    glkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhngyisegsgdn
    ifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysadeifvtgtaa
    eiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cm0B (B:)
    msellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarv
    idlkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpw
    gklygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhn
    gyisegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysa
    deifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cm0B (B:)
    ellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvid
    lkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpkly
    gdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhngyis
    egsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysadeif
    vtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cm0C (C:)
    msellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarv
    idlkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpw
    gklygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhn
    gyisegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysa
    deifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cm0C (C:)
    ellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvid
    lkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwkg
    lkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhngyisegsgdni
    fivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysadeifvtgtaae
    iapvtyidgrtvgngkpgkvtkmlmekfrertenegveiy