PDB entry 5chv

View 5chv on RCSB PDB site
Description: Crystal structure of USP18-ISG15 complex
Class: hydrolase
Keywords: Ubiquitin-specific protease, ISG15, interferon, hydrolase
Deposited on 2015-07-10, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubl carboxyl-terminal hydrolase 18
    Species: Mus musculus [TaxId:10090]
    Gene: Usp18, Ubp43
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5chva_
  • Chain 'B':
    Compound: Ubl carboxyl-terminal hydrolase 18
    Species: Mus musculus [TaxId:10090]
    Gene: Usp18, Ubp43
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5chvb_
  • Chain 'C':
    Compound: Ubiquitin-like protein ISG15
    Species: Mus musculus [TaxId:10090]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64339 (Start-154)
      • engineered mutation (75)
      • engineered mutation (154)
    Domains in SCOPe 2.07: d5chvc1, d5chvc2
  • Chain 'D':
    Compound: Ubiquitin-like protein ISG15
    Species: Mus musculus [TaxId:10090]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64339 (Start-154)
      • engineered mutation (75)
      • engineered mutation (154)
    Domains in SCOPe 2.07: d5chvd1, d5chvd2
  • Heterogens: ZN, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5chvA (A:)
    dsphglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqllllle
    kmqdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglf
    tiwtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmc
    cescgektpwkqvlklthlpqtltihlmrfsarnsrtekichsvnfpqsldfsqvlptee
    dlgdtkeqseihyelfaviahvgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqc
    tygnhryrwretayllvytktgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chvA (A:)
    hglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlllllekmq
    dsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglftiw
    tqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmcces
    cgektpwkqvlklthlpqtltihlmrfsarnsrtekichsvnfpqsldfsqvlihyelfa
    viahvgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqctygnhryrwretayllv
    ytkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5chvB (B:)
    dsphglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqllllle
    kmqdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglf
    tiwtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmc
    cescgektpwkqvlklthlpqtltihlmrfsarnsrtekichsvnfpqsldfsqvlptee
    dlgdtkeqseihyelfaviahvgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqc
    tygnhryrwretayllvytktgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chvB (B:)
    lvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlllllekmqds
    rqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglftiwtq
    eslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmccescg
    ektpwkqvlklthlpqtltihlmrfsarnsrtekichsvnfpqsldfsqihyelfaviah
    vgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqctygnhryrwretayllvytkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5chvC (C:)
    mawdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlss
    lglgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqf
    wlsfegrpmedkellgeyglkpqctvikhlrlrgx
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chvC (C:)
    awdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlssl
    glgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfw
    lsfegrpmedkellgeyglkpqctvikhlrlrgx
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5chvD (D:)
    mawdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlss
    lglgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqf
    wlsfegrpmedkellgeyglkpqctvikhlrlrgx
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chvD (D:)
    awdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlssl
    glgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfw
    lsfegrpmedkellgeyglkpqctvikhlrlrgx