PDB entry 5chf

View 5chf on RCSB PDB site
Description: Crystal structure of murine ISG15 in space group P21212
Class: antiviral protein
Keywords: ubiquitin-like protein, cell cycle, antiviral protein
Deposited on 2015-07-10, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein ISG15
    Species: Mus musculus [TaxId:10090]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64339
      • engineered mutation (75)
    Domains in SCOPe 2.07: d5chfa1, d5chfa2
  • Chain 'B':
    Compound: Ubiquitin-like protein ISG15
    Species: Mus musculus [TaxId:10090]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64339
      • engineered mutation (75)
    Domains in SCOPe 2.07: d5chfb1, d5chfb2
  • Chain 'C':
    Compound: Ubiquitin-like protein ISG15
    Species: Mus musculus [TaxId:10090]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64339
      • engineered mutation (75)
    Domains in SCOPe 2.07: d5chfc1, d5chfc2
  • Chain 'D':
    Compound: Ubiquitin-like protein ISG15
    Species: Mus musculus [TaxId:10090]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64339
      • engineered mutation (75)
    Domains in SCOPe 2.07: d5chfd1, d5chfd2
  • Chain 'E':
    Compound: Ubiquitin-like protein ISG15
    Species: Mus musculus [TaxId:10090]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64339
      • engineered mutation (75)
    Domains in SCOPe 2.07: d5chfe1, d5chfe2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5chfA (A:)
    mawdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlss
    lglgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqf
    wlsfegrpmedkellgeyglkpqctvikhlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chfA (A:)
    awdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlssl
    glgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfw
    lsfegrpmedkellgeyglkpqctvikhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5chfB (B:)
    mawdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlss
    lglgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqf
    wlsfegrpmedkellgeyglkpqctvikhlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chfB (B:)
    awdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlssl
    glgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfw
    lsfegrpmedkellgeyglkpqctvikhlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5chfC (C:)
    mawdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlss
    lglgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqf
    wlsfegrpmedkellgeyglkpqctvikhlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chfC (C:)
    awdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlssl
    glgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfw
    lsfegrpmedkellgeyglkpqctvikhl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5chfD (D:)
    mawdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlss
    lglgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqf
    wlsfegrpmedkellgeyglkpqctvikhlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chfD (D:)
    wdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlsslg
    lgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwl
    sfegrpmedkellgeyglkpqctvikhlr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5chfE (E:)
    mawdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlss
    lglgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqf
    wlsfegrpmedkellgeyglkpqctvikhlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chfE (E:)
    awdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlssl
    glgpsstvmlvvqnsseplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfw
    lsfegrpmedkellgeyglkpqctvikhlr