PDB entry 5cg0

View 5cg0 on RCSB PDB site
Description: Crystal structure of Spodoptera frugiperda Beta-glycosidase
Class: hydrolase
Keywords: GH1 Glycosil-hydrolase; Spodoptera frugiperda Beta-glycosidase, HYDROLASE
Deposited on 2015-07-08, released 2015-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O61594 (Start-488)
      • engineered mutation (304-305)
    Domains in SCOPe 2.06: d5cg0a_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O61594 (Start-488)
      • engineered mutation (304-305)
    Domains in SCOPe 2.06: d5cg0b_
  • Chain 'C':
    Compound: Beta-glucosidase
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O61594 (Start-488)
      • engineered mutation (304-305)
    Domains in SCOPe 2.06: d5cg0c_
  • Chain 'D':
    Compound: Beta-glucosidase
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O61594
      • engineered mutation (304-305)
    Domains in SCOPe 2.06: d5cg0d_
  • Chain 'E':
    Compound: Beta-glucosidase
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O61594
      • engineered mutation (304-305)
    Domains in SCOPe 2.06: d5cg0e_
  • Chain 'F':
    Compound: Beta-glucosidase
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O61594
      • engineered mutation (304-305)
    Domains in SCOPe 2.06: d5cg0f_
  • Heterogens: NAG, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cg0A (A:)
    qqrrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhn
    ykrdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitl
    yhwdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsat
    kapilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptped
    emaaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvr
    gtsdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsih
    talthlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkg
    ymawslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepet
    mvmtidegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cg0A (A:)
    qrrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhny
    krdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitly
    hwdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsatk
    apilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptpede
    maaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvrg
    tsdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsiht
    althlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkgy
    mawslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepetm
    vmtidegh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cg0B (B:)
    qqrrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhn
    ykrdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitl
    yhwdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsat
    kapilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptped
    emaaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvr
    gtsdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsih
    talthlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkg
    ymawslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepet
    mvmtidegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cg0B (B:)
    qrrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhny
    krdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitly
    hwdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsatk
    apilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptpede
    maaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvrg
    tsdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsiht
    althlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkgy
    mawslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepetm
    vmtidegh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cg0C (C:)
    qqrrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhn
    ykrdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitl
    yhwdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsat
    kapilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptped
    emaaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvr
    gtsdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsih
    talthlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkg
    ymawslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepet
    mvmtidegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cg0C (C:)
    qrrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhny
    krdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitly
    hwdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsatk
    apilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptpede
    maaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvrg
    tsdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsiht
    althlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkgy
    mawslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepetm
    vmtidegh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cg0D (D:)
    qqrrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhn
    ykrdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitl
    yhwdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsat
    kapilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptped
    emaaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvr
    gtsdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsih
    talthlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkg
    ymawslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepet
    mvmtidegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cg0D (D:)
    rrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhnyk
    rdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitlyh
    wdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsatka
    pilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptpedem
    aaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvrgt
    sdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsihta
    lthlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkgym
    awslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepetmv
    mtideg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5cg0E (E:)
    qqrrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhn
    ykrdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitl
    yhwdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsat
    kapilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptped
    emaaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvr
    gtsdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsih
    talthlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkg
    ymawslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepet
    mvmtidegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cg0E (E:)
    rrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhnyk
    rdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitlyh
    wdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsatka
    pilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptpedem
    aaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvrgt
    sdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsihta
    lthlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkgym
    awslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepetmv
    mtide
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5cg0F (F:)
    qqrrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhn
    ykrdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitl
    yhwdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsat
    kapilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptped
    emaaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvr
    gtsdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsih
    talthlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkg
    ymawslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepet
    mvmtidegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cg0F (F:)
    rrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhnyk
    rdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitlyh
    wdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsatka
    pilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptpedem
    aaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvrgt
    sdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsihta
    lthlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkgym
    awslmdnfewmegyierfglyevdfsdparrtprkaafvykhiikhrvvdy