PDB entry 5cfe

View 5cfe on RCSB PDB site
Description: Bacillus subtilis AP endonuclease ExoA
Class: hydrolase
Keywords: Hydrolase, AP endonuclease
Deposited on 2015-07-08, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: exoA, BSU40880
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cfea_
  • Heterogens: CA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cfeA (A:)
    mkliswnvnglravmrkmdflsylkeedadiiclqetkiqdgqvdlqpedyhvywnyavk
    kgysgtavfskqeplqviygigveehdqegrvitlefenvfvmtvytpnsrrgleridyr
    mqweeallsyileldqkkpvilcgdlnvahqeidlknpkanrnnagfsdqereaftrfle
    agfvdsfrhvypdlegayswwsyragardrnigwridyfvvseslkeqiedasisadvmg
    sdhcpveliini