PDB entry 5ce8

View 5ce8 on RCSB PDB site
Description: Crystal structure of branched-chain aminotransferase from thermophilic archaea Thermoproteus uzoniensis
Class: transferase
Keywords: aminotransferase, branched-chain, PLP, BCAT, transferase
Deposited on 2015-07-06, released 2016-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermoproteus uzoniensis (strain 768-20) [TaxId:999630]
    Gene: TUZN_1299
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2L0W0 (12-306)
      • expression tag (11)
    Domains in SCOPe 2.07: d5ce8a1, d5ce8a2
  • Chain 'B':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermoproteus uzoniensis (strain 768-20) [TaxId:999630]
    Gene: TUZN_1299
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2L0W0 (12-306)
      • expression tag (11)
    Domains in SCOPe 2.07: d5ce8b1, d5ce8b2
  • Chain 'C':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermoproteus uzoniensis (strain 768-20) [TaxId:999630]
    Gene: TUZN_1299
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ce8c_
  • Heterogens: PLP, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ce8A (A:)
    mrgshhhhhhgsmkvwldgrlvdeeeakvtvlspslnygfgvfegiraywngenlyvfrl
    rdhmerllrsakiigldvpytaeelskavvetvrangfkedlyirpvayiskpqisldvr
    glqasvaiaaipfgkylkvegvraavvswrrvhtsmmpvmakatgiylnsimaavearar
    gydeaimlnaegkvvegsgenifivrrgvlmtppledgilegitretvisiagdlgipll
    eksitreelyaadeaffvgtaaeitpiieidgrvlqrgpitqkiaetyrrivlgkeekyl
    pwltpvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ce8A (A:)
    smkvwldgrlvdeeeakvtvlspslnygfgvfegiraywngenlyvfrlrdhmerllrsa
    kiigldvpytaeelskavvetvrangfkedlyirpvayiskpqisldvrglqasvaiaai
    pfgkylkvegvraavvswrrvhtsmmpvmakatgiylnsimaavearargydeaimlnae
    gkvvegsgenifivrrgvlmtppledgilegitretvisiagdlgiplleksitreelya
    adeaffvgtaaeitpiieidgrvlqrgpitqkiaetyrrivlgkeekylpwltpvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ce8B (B:)
    mrgshhhhhhgsmkvwldgrlvdeeeakvtvlspslnygfgvfegiraywngenlyvfrl
    rdhmerllrsakiigldvpytaeelskavvetvrangfkedlyirpvayiskpqisldvr
    glqasvaiaaipfgkylkvegvraavvswrrvhtsmmpvmakatgiylnsimaavearar
    gydeaimlnaegkvvegsgenifivrrgvlmtppledgilegitretvisiagdlgipll
    eksitreelyaadeaffvgtaaeitpiieidgrvlqrgpitqkiaetyrrivlgkeekyl
    pwltpvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ce8B (B:)
    smkvwldgrlvdeeeakvtvlspslnygfgvfegiraywngenlyvfrlrdhmerllrsa
    kiigldvpytaeelskavvetvrangfkedlyirpvayiskpqisldvrglqasvaiaai
    pfgkylkvegvraavvswrrvhtsmmpvmakatgiylnsimaavearargydeaimlnae
    gkvvegsgenifivrrgvlmtppledgilegitretvisiagdlgiplleksitreelya
    adeaffvgtaaeitpiieidgrvlqrgpitqkiaetyrrivlgkeekylpwltpvy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ce8C (C:)
    mrgshhhhhhgsmkvwldgrlvdeeeakvtvlspslnygfgvfegiraywngenlyvfrl
    rdhmerllrsakiigldvpytaeelskavvetvrangfkedlyirpvayiskpqisldvr
    glqasvaiaaipfgkylkvegvraavvswrrvhtsmmpvmakatgiylnsimaavearar
    gydeaimlnaegkvvegsgenifivrrgvlmtppledgilegitretvisiagdlgipll
    eksitreelyaadeaffvgtaaeitpiieidgrvlqrgpitqkiaetyrrivlgkeekyl
    pwltpvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ce8C (C:)
    mkvwldgrlvdeeeakvtvlspslnygfgvfegiraywngenlyvfrlrdhmerllrsak
    iigldvpytaeelskavvetvrangfkedlyirpvayiskpqisldvrglqasvaiaaip
    fgkylkvegvraavvswrrvhtsmmpvmakatgiylnsimaavearargydeaimlnaeg
    kvvegsgenifivrrgvlmtppledgilegitretvisiagdlgiplleksitreelyaa
    deaffvgtaaeitpiieidgrvlqrgpitqkiaetyrrivlgkeekylpwltpvy