PDB entry 5ce4

View 5ce4 on RCSB PDB site
Description: High Resolution X-Ray and Neutron diffraction structure of H-FABP
Class: cell cycle
Keywords: FABP Lipocalin, cell cycle
Deposited on 2015-07-06, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAYNEUT
Resolution: 0.98 Å
R-factor: N/A
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ce4a_
  • Heterogens: OLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ce4A (A:)
    mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
    teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
    gtavctrtyeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ce4A (A:)
    vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
    eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
    tavctrtyeke