PDB entry 5ccd

View 5ccd on RCSB PDB site
Description: Joint X-ray/neutron structure of MTAN D198N complex with SAH
Class: Hydrolase
Keywords: Helicobacter pylori, Neutron, S-Adenosylhomocysteine, N-Glycosyl Hydrolases, Hydrolase
Deposited on 2015-07-01, released 2016-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAYNEUT
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminodeoxyfutalosine nucleosidase
    Species: Helicobacter pylori (strain J99 / ATCC 700824) [TaxId:85963]
    Gene: mtnN, mtn, jhp_0082
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZMY2 (3-231)
      • expression tag (2)
      • engineered mutation (199)
    Domains in SCOPe 2.06: d5ccda1, d5ccda2
  • Heterogens: SAH, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ccdA (A:)
    gpgqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhst
    ltttsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesa
    ifietsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegas
    vafvcqkfgvpccvlrsisnnadekagmsfdefleksahtsakflksmvdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ccdA (A:)
    gqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstlt
    ttsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaif
    ietsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasva
    fvcqkfgvpccvlrsisnnadekagmsfdefleksahtsakflksmvdel