PDB entry 5cbk

View 5cbk on RCSB PDB site
Description: Crystal structure of the strigolactone receptor ShHTL5 from Striga hermonthica
Class: signaling protein
Keywords: Striga hermonthica, strigolactone, signalling, receptor, ShHTL5, alpha/beta hydrolase, SIGNALING PROTEIN
Deposited on 2015-07-01, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ShHTL5
    Species: Striga hermonthica [TaxId:68872]
    Gene: ShHTL5
    Database cross-references and differences (RAF-indexed):
    • PDB 5CBK (0-270)
    Domains in SCOPe 2.07: d5cbka_
  • Heterogens: MG, PE3, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cbkA (A:)
    mstvgsahnvtvlgsgettvvlghgfgtdqsvwkylvphltddyrvllydnmgagttdpn
    lydferyssleghsqdliaileefhvtkcifvghslssmvgavssifrpdlfrkivmisa
    cprvanaddyyggfeeedvnqlygameenfqtmmtgyapivvggdleseamqefsrtlfn
    mrpdialsicrmisgydlrpylglvvipchiiqsskdklvpvavaeylhrnfggksvvel
    ipteghlphlsapditipvlirhinqdiadd