PDB entry 5cbe

View 5cbe on RCSB PDB site
Description: E10 in complex with CXCL13
Class: immune system
Keywords: anti-CXCL13, E10, scFv, IMMUNE SYSTEM
Deposited on 2015-06-30, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E10 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV1-69-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cbea_
  • Chain 'B':
    Compound: E10 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04209 (Start-91)
      • conflict (11)
      • conflict (25)
      • conflict (30)
      • conflict (33)
      • conflict (50)
      • conflict (54)
      • conflict (59)
      • conflict (61)
      • conflict (90)
    • PDB 5CBE (90-End)
    Domains in SCOPe 2.07: d5cbeb_
  • Chain 'C':
    Compound: E10 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV1-69-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cbec_
  • Chain 'D':
    Compound: E10 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04209 (0-91)
      • conflict (11)
      • conflict (25)
      • conflict (30)
      • conflict (33)
      • conflict (50)
      • conflict (54)
      • conflict (59)
      • conflict (61)
      • conflict (90)
    • PDB 5CBE (90-End)
    Domains in SCOPe 2.07: d5cbed_
  • Chain 'E':
    Compound: C-X-C motif chemokine 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL13, BCA1, BLC, SCYB13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cbee_
  • Chain 'F':
    Compound: C-X-C motif chemokine 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL13, BCA1, BLC, SCYB13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cbef_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cbeA (A:)
    qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
    ttvtvssggggsggggsggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbeA (A:)
    qvqlvqsgaevkkpgssvkvsckasgfssyaiswvrqapgqglewmggiipifgtanyaq
    kfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqgtt
    vtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cbeB (B:)
    qsaltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgv
    shrfsgsksgntasltisglqaedeadyycasatlldtyvfgtgtkvtvlgdqepkssdk
    th
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbeB (B:)
    saltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgvs
    hrfsgsksgntasltisglqaedeadyycasatlldtyvfgtgtkvtvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cbeC (C:)
    qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
    ttvtvssggggsggggsggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbeC (C:)
    qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
    ttvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cbeD (D:)
    qsaltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgv
    shrfsgsksgntasltisglqaedeadyycasatlldtyvfgtgtkvtvlgdqepkssdk
    th
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbeD (D:)
    qsaltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgv
    shrfsgsksgntasltisglqaedeadyycasatlldtyvfgtgtkvtvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5cbeE (E:)
    mvlevyytslrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqa
    ewiqrmmevlrkrssstlpvpvfkrkip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbeE (E:)
    yytslrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqaewiqr
    mmev
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5cbeF (F:)
    mvlevyytslrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqa
    ewiqrmmevlrkrssstlpvpvfkrkip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbeF (F:)
    tslrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqaewiqrmm
    evlrkr