PDB entry 5cba

View 5cba on RCSB PDB site
Description: 3B4 in complex with CXCL13 - 3B4-CXCL13
Class: immune system
Keywords: anti-CXCL13, CXCL13, scFv, IMMUNE SYSTEM
Deposited on 2015-06-30, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3b4 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV1-69-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cbaa_
  • Chain 'B':
    Compound: 3B4 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04209 (0-91)
      • conflict (11)
      • conflict (25)
      • conflict (30)
      • conflict (33)
      • conflict (50)
      • conflict (54)
      • conflict (59)
      • conflict (61)
    • PDB 5CBA (92-End)
    Domains in SCOPe 2.07: d5cbab1, d5cbab2
  • Chain 'C':
    Compound: 3b4 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV1-69-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cbac_
  • Chain 'D':
    Compound: 3B4 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04209 (0-91)
      • conflict (11)
      • conflict (25)
      • conflict (30)
      • conflict (33)
      • conflict (50)
      • conflict (54)
      • conflict (59)
      • conflict (61)
    • PDB 5CBA (92-End)
    Domains in SCOPe 2.07: d5cbad1, d5cbad2
  • Chain 'E':
    Compound: C-X-C motif chemokine 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL13, BCA1, BLC, SCYB13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cbae_
  • Chain 'F':
    Compound: C-X-C motif chemokine 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL13, BCA1, BLC, SCYB13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cbaf_
  • Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cbaA (A:)
    qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
    ttvtvssggggsggggsggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbaA (A:)
    qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
    ttvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cbaB (B:)
    qsaltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgv
    shrfsgsksgntasltisglqaedeadyycssytrrdtyvfgtgtkvtvlgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbaB (B:)
    qsaltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgv
    shrfsgsksgntasltisglqaedeadyycssytrrdtyvfgtgtkvtvlge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cbaC (C:)
    qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
    ttvtvssggggsggggsggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbaC (C:)
    qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
    ttvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cbaD (D:)
    qsaltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgv
    shrfsgsksgntasltisglqaedeadyycssytrrdtyvfgtgtkvtvlgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbaD (D:)
    qsaltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgv
    shrfsgsksgntasltisglqaedeadyycssytrrdtyvfgtgtkvtvlg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5cbaE (E:)
    mvlevyytslrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqa
    ewiqrmmevlrkrssstlpvpvfkrkip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbaE (E:)
    rcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqaewiqrmmevl
    r
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5cbaF (F:)
    mvlevyytslrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqa
    ewiqrmmevlrkrssstlpvpvfkrkip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cbaF (F:)
    slrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqaewiqrmme
    vlrk