PDB entry 5c9a

View 5c9a on RCSB PDB site
Description: Crystal structure of empty coxsackievirus A16 particle
Class: virus
Keywords: hand-foot-and-mouth disease, immunogenicity, picornavirus, icosahedral virus, virus
Deposited on 2015-06-26, released 2015-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Coxsackievirus A16 [TaxId:31704]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c9aa_
  • Chain 'B':
    Compound: vp0
    Species: Coxsackievirus A16 [TaxId:31704]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: vp3
    Species: Coxsackievirus A16 [TaxId:31704]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c9ac_
  • Heterogens: SPH, K, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c9aA (A:)
    gdpiadmidqtvnnqvnrsltalqvlptaanteasshrlgtgvvpalqaaetgassnasd
    knlietrcvlnhhstqetaignffsraglvsiitmpttgtqntdgyvnwdidlmgyaqlr
    rkcelftymrfdaeftfvvakpngelvpqllqymyvppgapkptsrdsfawqtatnpsvf
    vkmtdppaqvsvpfmspasayqwfydgyptfgehlqandldygqcpnnmmgtfsirtvgi
    eksphsitlrvymrikhvrawiprplrnqpylfktnpnykgndikctstsrdkittl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c9aA (A:)
    dpiadmisltalqvlptaanteasshrvvpalqaaetgassnasdknlietrcvlnhhst
    qetaignffsraglvsiitmpttgtqntdgyvnwdidlmgyaqlrrkcelftymrfdaef
    tfvvakpngelvpqllqymyvppgapkptsrdsfawqtatnpsvfvkmtdppaqvsvpfm
    spasayqwfydgyptfgehlqandldygqcpnnmmgtfsirtvgieksphsitlrvymri
    khvrawiprplrnqpylfktnpnykgndikctstsrdkittl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c9aC (C:)
    giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
    nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
    fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah
    aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedieqtan
    iq