PDB entry 5c8w

View 5c8w on RCSB PDB site
Description: PKG II's Amino Terminal Cyclic Nucleotide Binding Domain (CNB-A) in a complex with cGMP
Class: transferase
Keywords: Binding Sites, Cyclic AMP, Cyclic GMP, Cyclic GMP-Dependent Protein Kinase Type II, Mutagenesis, Site-Directed, Protein Binding, TRANSFERASE
Deposited on 2015-06-26, released 2016-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG2, PRKGR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c8wa_
  • Chain 'B':
    Compound: cGMP-dependent protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG2, PRKGR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c8wb_
  • Chain 'C':
    Compound: cGMP-dependent protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG2, PRKGR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c8wc_
  • Chain 'D':
    Compound: cGMP-dependent protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG2, PRKGR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c8wd_
  • Chain 'E':
    Compound: cGMP-dependent protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG2, PRKGR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c8we_
  • Chain 'F':
    Compound: cGMP-dependent protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG2, PRKGR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c8wf_
  • Heterogens: MLA, PCG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c8wA (A:)
    gsnkppefsfekarvrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsy
    iikqgepgnhifvlaegrlevfqgekllssipmwttfgelailynctrtasvkaitnvkt
    waldrevfqnimrrtaqardeqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c8wA (A:)
    rkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsyiikqgepgnhifvla
    egrlevfqgekllssipmwttfgelailynctrtasvkaitnvktwaldrevfqnimrrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c8wB (B:)
    gsnkppefsfekarvrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsy
    iikqgepgnhifvlaegrlevfqgekllssipmwttfgelailynctrtasvkaitnvkt
    waldrevfqnimrrtaqardeqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c8wB (B:)
    arvrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsyiikqgepgnhif
    vlaegrlevfqgekllssipmwttfgelailynctrtasvkaitnvktwaldrevfqnim
    r
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5c8wC (C:)
    gsnkppefsfekarvrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsy
    iikqgepgnhifvlaegrlevfqgekllssipmwttfgelailynctrtasvkaitnvkt
    waldrevfqnimrrtaqardeqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c8wC (C:)
    vrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsyiikqgepgnhifvl
    aegrlevfqgekllssipmwttfgelailynctrtasvkaitnvktwaldrevfqnimrr
    t
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5c8wD (D:)
    gsnkppefsfekarvrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsy
    iikqgepgnhifvlaegrlevfqgekllssipmwttfgelailynctrtasvkaitnvkt
    waldrevfqnimrrtaqardeqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c8wD (D:)
    vrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsyiikqgepgnhifvl
    aegrlevfqgekllssipmwttfgelailynctrtasvkaitnvktwaldrevfqnimr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5c8wE (E:)
    gsnkppefsfekarvrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsy
    iikqgepgnhifvlaegrlevfqgekllssipmwttfgelailynctrtasvkaitnvkt
    waldrevfqnimrrtaqardeqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c8wE (E:)
    rkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsyiikqgepgnhifvla
    egrlevfqgekllssipmwttfgelailynctrtasvkaitnvktwaldrevfqnimrr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5c8wF (F:)
    gsnkppefsfekarvrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsy
    iikqgepgnhifvlaegrlevfqgekllssipmwttfgelailynctrtasvkaitnvkt
    waldrevfqnimrrtaqardeqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c8wF (F:)
    kdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsyiikqgepgnhifvlae
    grlevfqgekllssipmwttfgelailynctrtasvkaitnvktwaldrevfqnimrr