PDB entry 5c86

View 5c86 on RCSB PDB site
Description: Novel fungal alcohol oxidase with catalytic diversity among the AA5 family, apo form
Class: oxidoreductase
Keywords: Kelch motif, AA5, Fungal alcohol oxidase, oxidoreductase
Deposited on 2015-06-25, released 2015-07-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch domain-containing protein
    Species: Colletotrichum graminicola M1.001 [TaxId:645133]
    Gene: GLRG_05590
    Database cross-references and differences (RAF-indexed):
    • Uniprot E3QHV8 (Start-481)
      • expression tag (482)
    Domains in SCOPe 2.06: d5c86a1, d5c86a2, d5c86a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c86A (A:)
    qnvgkwgpmvkfpvvpvavalvpetgnllvwssgwpnrwttagngktytslynvntgnis
    daivqntqhdmfcpgtsldadgriivtggssaaktsvldfkkgesspwtplsnmqisrgy
    qsscttsegkifviggsfsgagtrngevydpkantwtklagcpvkplvmqrgmfpdshaw
    lwswkngsvlqagpskkmnwydtkgtgsntpaglrgtdedsmcgvsvmydavagkiftyg
    ggkgytgydstsnahiltlgepgqavqvqklangkynrgfanavvmpdgkiwvvggmqkm
    wlfsdttpqltpelfdpatgsftpttphtvprnyhstallmadatiwsgggglcgancke
    nhfdgqfwsppylfeadgvtpakrpviqslsdtavragapititmqdagaytfsmirvsa
    tthtvntdqrripldgqdggdgksftvnvpndygvaipgyymlfamneagvpcvaqffkv
    tlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c86A (A:)
    nvgkwgpmvkfpvvpvavalvpetgnllvwssgwpnrwttagngktytslynvntgnisd
    aivqntqhdmfcpgtsldadgriivtggssaaktsvldfkkgesspwtplsnmqisrgyq
    sscttsegkifviggsfsgagtrngevydpkantwtklagcpvkplvmqrgmfpdshawl
    wswkngsvlqagpskkmnwydtkgtgsntpaglrgtdedsmcgvsvmydavagkiftygg
    gkgytgydstsnahiltlgepgqavqvqklangkynrgfanavvmpdgkiwvvggmqkmw
    lfsdttpqltpelfdpatgsftpttphtvprnyhstallmadatiwsgggglcgancken
    hfdgqfwsppylfeadgvtpakrpviqslsdtavragapititmqdagaytfsmirvsat
    thtvntdqrripldgqdggdgksftvnvpndygvaipgyymlfamneagvpcvaqffkvt
    lh