PDB entry 5c7m

View 5c7m on RCSB PDB site
Description: crystal structure of e3 ligase itch with a ub variant
Class: ligase/signaling protein
Keywords: LIGASE, UBIQUITIN-PROTEIN LIGASE, UBIQUITIN VARIANT, Structural Genomics Consortium, SGC, Structural Genomics, LIGASE-SIGNALING PROTEIN complex
Deposited on 2015-06-24, released 2016-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 3.03 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Itchy homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: ITCH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96J02 (Start-393)
      • conflict (99)
      • conflict (295)
    Domains in SCOPe 2.06: d5c7ma_
  • Chain 'B':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-End)
      • engineered mutation (1)
      • engineered mutation (3)
      • engineered mutation (8)
      • engineered mutation (43)
      • engineered mutation (45)
      • engineered mutation (47-48)
      • engineered mutation (65)
      • engineered mutation (67)
      • engineered mutation (69)
      • engineered mutation (72)
    Domains in SCOPe 2.06: d5c7mb_
  • Chain 'C':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-End)
      • engineered mutation (1)
      • engineered mutation (3)
      • engineered mutation (8)
      • engineered mutation (43)
      • engineered mutation (45)
      • engineered mutation (47-48)
      • engineered mutation (65)
      • engineered mutation (67)
      • engineered mutation (69)
    Domains in SCOPe 2.06: d5c7mc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c7mA (A:)
    mhhhhhhssgrenlyfqgyvrdfkakvqyfrfwcqqlampqhikitvtrktlfedsfqqi
    msfspqdlrrrlwvifpgeegldyggvarewffllshevsnpmyclfeyagkdnyclqin
    pasyinpdhlkyfrfigrfiamalfhgkfidtgfslpfykrilnkpvglkdlesidpefy
    nsliwvkennieecdlemyfsvdkeilgeikshdlkpnggnilvteenkeeyirmvaewr
    lsrgveeqtqaffegfneilpqqylqyfdakelevllcgmqeidlndwqrhaiyrryart
    skqimwfwqfvkeidnekrmrllqfvtgtcrlpvggfadlmgsngpqkfciekvgkenwl
    prshtcfnrldlppyksyeqlkekllfaieeteg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c7mA (A:)
    rdfkakvqyfrfwcqqlampqhikitvtrktlfedsfqqimsfspqdlrrrlwvifpgee
    gldyggvarewffllshevsnpmyclfeyagkclqinpasyinpdhlkyfrfigrfiama
    lfhgkfidtgfslpfykrilnkpvglkdlesidpefynsliwvkennieecdlemyfsvd
    kelgeikshdlkpnggnilvteenkeeyirmvaewrlsrgveeqtqaffegfneilpqqy
    lqyfdakelevllcgmqeidlndwqrhaiyrryartskqimwfwqfvkeidnekrmrllq
    fvtgtcrlpvggfadlmgsngpqkfciekvgkenwlprshtcfnrldlppyksyeqlkek
    llfaieeteg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c7mB (B:)
    mhilvktlrgktitlevepsdtienvkakiqdkegippdqqrllfggnkledgrtlsdyn
    iqkesnlylllrrlgskfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c7mB (B:)
    mhilvktlrgktitlevepsdtienvkakiqdkegippdqqrllfggnkledgrtlsdyn
    iqkesnlylllrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5c7mC (C:)
    mhilvktlrgktitlevepsdtienvkakiqdkegippdqqrllfggnkledgrtlsdyn
    iqkesnlylllrrlgskfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c7mC (C:)
    mhilvktlrgktitlevepsdtienvkakiqdkegippdqqrllfggnkledgrtlsdyn
    qkesnlylllr