PDB entry 5c7j

View 5c7j on RCSB PDB site
Description: crystal structure of nedd4 with a ub variant
Class: ligase/signaling protein
Keywords: LIGASE, UBIQUITIN-PROTEIN LIGASE, UBIQUITIN VARIANT, Structural Genomics Consortium, SGC, Structural Genomics, LIGASE-SIGNALING PROTEIN complex
Deposited on 2015-06-24, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase NEDD4
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD4, KIAA0093, NEDD4-1, PIG53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c7ja_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase NEDD4
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD4, KIAA0093, NEDD4-1, PIG53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c7jb_
  • Chain 'C':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48
      • expression tag (2-14)
      • engineered mutation (26)
      • engineered mutation (28-29)
      • engineered mutation (79-81)
      • engineered mutation (83)
      • engineered mutation (88)
    Domains in SCOPe 2.07: d5c7jc1, d5c7jc2
  • Chain 'D':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48
      • expression tag (2-14)
      • engineered mutation (26)
      • engineered mutation (28-29)
      • engineered mutation (79-81)
      • engineered mutation (83)
      • engineered mutation (88)
    Domains in SCOPe 2.07: d5c7jd1, d5c7jd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c7jA (A:)
    grdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwiefd
    gekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsglcnedhlsyfkfi
    grvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteldl
    rfiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegffe
    lipqdlikifdenelellmcglgdvdvndwrehtkykngysanhqviqwfwkavlmmdse
    krirllqfvtgtsrvpmngfaelygsngpqsftveqwgtpeklprahtcfnrldlppyes
    feelwdklqmaientqgfdgvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c7jA (A:)
    rdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwiefdg
    ekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsglcnedhlsyfkfig
    rvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteldlr
    fiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegffel
    ipqdlikifdenelellmcglgdvdvndwrehtkykngysanhqviqwfwkavlmmdsek
    rirllqfvtgtsrvpmngfaelygpqsftveqwgtpeklprahtcfnrldlppyesfeel
    wdklqmaientqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c7jB (B:)
    grdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwiefd
    gekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsglcnedhlsyfkfi
    grvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteldl
    rfiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegffe
    lipqdlikifdenelellmcglgdvdvndwrehtkykngysanhqviqwfwkavlmmdse
    krirllqfvtgtsrvpmngfaelygsngpqsftveqwgtpeklprahtcfnrldlppyes
    feelwdklqmaientqgfdgvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c7jB (B:)
    rdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwiefdg
    ekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsglcnedhlsyfkfig
    rvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteldlr
    fiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegffel
    ipqdlikifdenelellmcglgdvdvndwrehtkykngysanhqviqwfwkavlmmdsek
    rirllqfvtgtsrvpmngfaelypqsftveqwgtpeklprahtcfnrldlppyesfeelw
    dklqmaientqgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5c7jC (C:)
    ahhhhhhvtslykkagstmqifvktlagwgitlevepsdtienvkakiqdkegippdqqr
    lifagkqledgrtlsdynirydsqlhlvgrlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c7jC (C:)
    hhhhhvtslykkaqifvktlagwgitlevepsdtienvkakiqdkegippdqqrlifagk
    qledgrtlsdynirydsqlhlvgrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5c7jD (D:)
    ahhhhhhvtslykkagstmqifvktlagwgitlevepsdtienvkakiqdkegippdqqr
    lifagkqledgrtlsdynirydsqlhlvgrlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c7jD (D:)
    hhhhhvtslykkaqifvktlagwgitlevepsdtienvkakiqdkegippdqqrlifagk
    qledgrtlsdynirydsqlhlvgrl