PDB entry 5c71

View 5c71 on RCSB PDB site
Description: The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide
Class: hydrolase
Keywords: beta-glucuronidase; glycyrrhetinic acid monoglucuronide, HYDROLASE
Deposited on 2015-06-24, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucuronidase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: Pgus
    Database cross-references and differences (RAF-indexed):
    • PDB 5C71
    Domains in SCOPe 2.07: d5c71a1, d5c71a2, d5c71a3
  • Chain 'B':
    Compound: Glucuronidase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: Pgus
    Database cross-references and differences (RAF-indexed):
    • PDB 5C71
    Domains in SCOPe 2.07: d5c71b1, d5c71b2, d5c71b3
  • Chain 'C':
    Compound: Glucuronidase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: Pgus
    Database cross-references and differences (RAF-indexed):
    • PDB 5C71
    Domains in SCOPe 2.07: d5c71c1, d5c71c2, d5c71c3
  • Chain 'D':
    Compound: Glucuronidase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: Pgus
    Database cross-references and differences (RAF-indexed):
    • PDB 5C71
    Domains in SCOPe 2.07: d5c71d1, d5c71d2, d5c71d3
  • Heterogens: CBW, GCU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c71A (A:)
    mgsshhhhhhssglvprgshmasmtggqqgrgsmlkpqqtttrdlisldglwkfalasdd
    nntqpwtsqlktslecpvpasyndifadskihdhvgwvyyqrdvivpkgwseerylvrce
    aathhgriyvngnlvadhvggytpfeaditdlvaageqfrltiavdneltyqtippgkve
    ileatgkkvqtyqhdfynyaglarsvwlysvpqqhiqditvrtdvqgttglidynvvast
    tqgtiqvavidedgttvatssgsngtihipsvhlwqpgaaylyqlhasiidsskktidty
    klatgirtvkvqgtqflindkpfyftgfgkhedtnirgkghddaymvhdfqllhwmgans
    frtshypyaeevmeyadrqgivvidetpavglafsigagaqtsnppatfspdrinnktre
    ahaqairelihrdknhpsvvmwsiandpasnedgareyfaplpklarqldptrpvtfanv
    glatykadriadlfdvlclnryfgwytqtaeldeaeaaleeelrgwtekydkpivmtdyg
    adtvaglhsvmvtpwseefqvemldmyhrvfdrfeamageqvwnfadfqtavgvsrvdgn
    kkgvftrdrkpkaaahllrkrwtnlhngtaeggktfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c71A (A:)
    mlkpqqtttrdlisldglwkfalasddnntqpwtsqlktslecpvpasyndifadskihd
    hvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpfeaditdlv
    aageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglarsvwlysvpq
    qhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsngtihipsvh
    lwqpgaaylyqlhasiidsskktidtyklatgirtvkvqgtqflindkpfyftgfgkhed
    tnirgkghddaymvhdfqllhwmgansfrtshypyaeevmeyadrqgivvidetpavgla
    fspatfspdrinnktreahaqairelihrdknhpsvvmwsiandpasnedgareyfaplp
    klarqldptrpvtfanvglatykadriadlfdvlclnryfgwytqtaeldeaeaaleeel
    rgwtekydkpivmtdygadtvaglhsvmvtpwseefqvemldmyhrvfdrfeamageqvw
    nfadfqtavgvsrvdgnkkgvftrdrkpkaaahllrkrwtnlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c71B (B:)
    mgsshhhhhhssglvprgshmasmtggqqgrgsmlkpqqtttrdlisldglwkfalasdd
    nntqpwtsqlktslecpvpasyndifadskihdhvgwvyyqrdvivpkgwseerylvrce
    aathhgriyvngnlvadhvggytpfeaditdlvaageqfrltiavdneltyqtippgkve
    ileatgkkvqtyqhdfynyaglarsvwlysvpqqhiqditvrtdvqgttglidynvvast
    tqgtiqvavidedgttvatssgsngtihipsvhlwqpgaaylyqlhasiidsskktidty
    klatgirtvkvqgtqflindkpfyftgfgkhedtnirgkghddaymvhdfqllhwmgans
    frtshypyaeevmeyadrqgivvidetpavglafsigagaqtsnppatfspdrinnktre
    ahaqairelihrdknhpsvvmwsiandpasnedgareyfaplpklarqldptrpvtfanv
    glatykadriadlfdvlclnryfgwytqtaeldeaeaaleeelrgwtekydkpivmtdyg
    adtvaglhsvmvtpwseefqvemldmyhrvfdrfeamageqvwnfadfqtavgvsrvdgn
    kkgvftrdrkpkaaahllrkrwtnlhngtaeggktfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c71B (B:)
    mlkpqqtttrdlisldglwkfalasddnntqpwtsqlktslecpvpasyndifadskihd
    hvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpfeaditdlv
    aageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglarsvwlysvpq
    qhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsngtihipsvh
    lwqpgaaylyqlhasiidsskktidtyklatgirtvkvqgtqflindkpfyftgfgkhed
    tnirgkghddaymvhdfqllhwmgansfrtshypyaeevmeyadrqgivvidetpavgla
    fspatfspdrinnktreahaqairelihrdknhpsvvmwsiandpasnedgareyfaplp
    klarqldptrpvtfanvglatykadriadlfdvlclnryfgwytqtaeldeaeaaleeel
    rgwtekydkpivmtdygadtvaglhsvmvtpwseefqvemldmyhrvfdrfeamageqvw
    nfadfqtavgvsrvdgnkkgvftrdrkpkaaahllrkrwtnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5c71C (C:)
    mgsshhhhhhssglvprgshmasmtggqqgrgsmlkpqqtttrdlisldglwkfalasdd
    nntqpwtsqlktslecpvpasyndifadskihdhvgwvyyqrdvivpkgwseerylvrce
    aathhgriyvngnlvadhvggytpfeaditdlvaageqfrltiavdneltyqtippgkve
    ileatgkkvqtyqhdfynyaglarsvwlysvpqqhiqditvrtdvqgttglidynvvast
    tqgtiqvavidedgttvatssgsngtihipsvhlwqpgaaylyqlhasiidsskktidty
    klatgirtvkvqgtqflindkpfyftgfgkhedtnirgkghddaymvhdfqllhwmgans
    frtshypyaeevmeyadrqgivvidetpavglafsigagaqtsnppatfspdrinnktre
    ahaqairelihrdknhpsvvmwsiandpasnedgareyfaplpklarqldptrpvtfanv
    glatykadriadlfdvlclnryfgwytqtaeldeaeaaleeelrgwtekydkpivmtdyg
    adtvaglhsvmvtpwseefqvemldmyhrvfdrfeamageqvwnfadfqtavgvsrvdgn
    kkgvftrdrkpkaaahllrkrwtnlhngtaeggktfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c71C (C:)
    mlkpqqtttrdlisldglwkfalasddnntqpwtsqlktslecpvpasyndifadskihd
    hvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpfeaditdlv
    aageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglarsvwlysvpq
    qhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsngtihipsvh
    lwqpgaaylyqlhasiidsskktidtyklatgirtvkvqgtqflindkpfyftgfgkhed
    tnirgkghddaymvhdfqllhwmgansfrtshypyaeevmeyadrqgivvidetpavgla
    fspatfspdrinnktreahaqairelihrdknhpsvvmwsiandpasnedgareyfaplp
    klarqldptrpvtfanvglatykadriadlfdvlclnryfgwytqtaeldeaeaaleeel
    rgwtekydkpivmtdygadtvaglhsvmvtpwseefqvemldmyhrvfdrfeamageqvw
    nfadfqtavgvsrvdgnkkgvftrdrkpkaaahllrkrwtnlh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5c71D (D:)
    mgsshhhhhhssglvprgshmasmtggqqgrgsmlkpqqtttrdlisldglwkfalasdd
    nntqpwtsqlktslecpvpasyndifadskihdhvgwvyyqrdvivpkgwseerylvrce
    aathhgriyvngnlvadhvggytpfeaditdlvaageqfrltiavdneltyqtippgkve
    ileatgkkvqtyqhdfynyaglarsvwlysvpqqhiqditvrtdvqgttglidynvvast
    tqgtiqvavidedgttvatssgsngtihipsvhlwqpgaaylyqlhasiidsskktidty
    klatgirtvkvqgtqflindkpfyftgfgkhedtnirgkghddaymvhdfqllhwmgans
    frtshypyaeevmeyadrqgivvidetpavglafsigagaqtsnppatfspdrinnktre
    ahaqairelihrdknhpsvvmwsiandpasnedgareyfaplpklarqldptrpvtfanv
    glatykadriadlfdvlclnryfgwytqtaeldeaeaaleeelrgwtekydkpivmtdyg
    adtvaglhsvmvtpwseefqvemldmyhrvfdrfeamageqvwnfadfqtavgvsrvdgn
    kkgvftrdrkpkaaahllrkrwtnlhngtaeggktfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c71D (D:)
    mlkpqqtttrdlisldglwkfalasddnntqpwtsqlktslecpvpasyndifadskihd
    hvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpfeaditdlv
    aageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglarsvwlysvpq
    qhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsngtihipsvh
    lwqpgaaylyqlhasiidsskktidtyklatgirtvkvqgtqflindkpfyftgfgkhed
    tnirgkghddaymvhdfqllhwmgansfrtshypyaeevmeyadrqgivvidetpavgla
    fspatfspdrinnktreahaqairelihrdknhpsvvmwsiandpasnedgareyfaplp
    klarqldptrpvtfanvglatykadriadlfdvlclnryfgwytqtaeldeaeaaleeel
    rgwtekydkpivmtdygadtvaglhsvmvtpwseefqvemldmyhrvfdrfeamageqvw
    nfadfqtavgvsrvdgnkkgvftrdrkpkaaahllrkrwtnl