PDB entry 5c70

View 5c70 on RCSB PDB site
Description: The structure of Aspergillus oryzae beta-glucuronidase
Class: hydrolase
Keywords: beta-glucuronidase, HYDROLASE
Deposited on 2015-06-24, released 2016-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucuronidase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: Pgus
    Database cross-references and differences (RAF-indexed):
    • PDB 5C70 (0-End)
    Domains in SCOPe 2.06: d5c70a1, d5c70a2, d5c70a3
  • Chain 'B':
    Compound: Glucuronidase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: Pgus
    Database cross-references and differences (RAF-indexed):
    • PDB 5C70
    Domains in SCOPe 2.06: d5c70b1, d5c70b2, d5c70b3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c70A (A:)
    aaqgsagsmlkpqqtttrdlisldglwkfalasddnntqpwtsqlktslecpvpasyndi
    fadskihdhvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpf
    eaditdlvaageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglars
    vwlysvpqqhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsng
    tihipsvhlwqpgaaylyqlhasiidsskktidtyklatgirtvkvqgtqflindkpfyf
    tgfgkhedtnirgkghddaymvhdfqllhwmgansfrtshypyaeevmeyadrqgivvid
    etpavglafsigagaqtsnppatfspdrinnktreahaqairelihrdknhpsvvmwsia
    nepasnedgareyfaplpklarqldptrpvtfanvglatykadriadlfdvlclnryfgw
    ytqtaeldeaeaaleeelrgwtekydkpivmteygadtvaglhsvmvtpwseefqvemld
    myhrvfdrfeamageqvwnfadfqtavgvsrvdgnkkgvftrdrkpkaaahllrkrwtnl
    hngtaeggktfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c70A (A:)
    aaqgsagsmlkpqqtttrdlisldglwkfalastqpwtsqlktslecpvpasyndifads
    kihdhvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpfeadi
    tdlvaageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglarsvwly
    svpqqhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsngtihi
    psvhlwqpgaaylyqlhasiidsskktidtyklatgirtvkvqgtqflindkpfyftgfg
    khedtnirgkghddaymvhdfqllhwmgansfrtshypyaeevmeyadrqgivvidetpa
    vglafsipatfspdrinnktreahaqairelihrdknhpsvvmwsianepasnedgarey
    faplpklarqldptrpvtfanvglatykadriadlfdvlclnryfgwytqtaeldeaeaa
    leeelrgwtekydkpivmteygadtvaglhsvmvtpwseefqvemldmyhrvfdrfeama
    geqvwnfadfqtavgvsrvdgnkkgvftrdrkpkaaahllrkrwtnlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c70B (B:)
    aaqgsagsmlkpqqtttrdlisldglwkfalasddnntqpwtsqlktslecpvpasyndi
    fadskihdhvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpf
    eaditdlvaageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglars
    vwlysvpqqhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsng
    tihipsvhlwqpgaaylyqlhasiidsskktidtyklatgirtvkvqgtqflindkpfyf
    tgfgkhedtnirgkghddaymvhdfqllhwmgansfrtshypyaeevmeyadrqgivvid
    etpavglafsigagaqtsnppatfspdrinnktreahaqairelihrdknhpsvvmwsia
    nepasnedgareyfaplpklarqldptrpvtfanvglatykadriadlfdvlclnryfgw
    ytqtaeldeaeaaleeelrgwtekydkpivmteygadtvaglhsvmvtpwseefqvemld
    myhrvfdrfeamageqvwnfadfqtavgvsrvdgnkkgvftrdrkpkaaahllrkrwtnl
    hngtaeggktfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c70B (B:)
    gsmlkpqqtttrdlisldglwkfalasddnntqpwtsqlktslecpvpasyndifadski
    hdhvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpfeaditd
    lvaageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglarsvwlysv
    pqqhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsngtihips
    vhlwqpgaaylyqlhasiidsskktidtyklatgirtvkvqgtqflindkpfyftgfgkh
    edtnirgkghddaymvhdfqllhwmgansfrtshypyaeevmeyadrqgivvidetpavg
    lafspatfspdrinnktreahaqairelihrdknhpsvvmwsianepasnedgareyfap
    lpklarqldptrpvtfanvglatykadriadlfdvlclnryfgwytqtaeldeaeaalee
    elrgwtekydkpivmteygadtvaglhsvmvtpwseefqvemldmyhrvfdrfeamageq
    vwnfadfqtavgvsrvdgnkkgvftrdrkpkaaahllrkrwtnl