PDB entry 5c6y

View 5c6y on RCSB PDB site
Description: A sperm whale myoglobin double mutant L29H/F43Y Mb with a Tyr-heme cross-link
Class: metal binding protein
Keywords: myoglobin, METAL BINDING PROTEIN (FE), METAL BINDING PROTEIN
Deposited on 2015-06-24, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (Start-153)
      • engineered mutation (29)
      • engineered mutation (43)
    Domains in SCOPe 2.07: d5c6ya_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c6yA (A:)
    mvlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekydrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6yA (A:)
    vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekydrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg