PDB entry 5c6n

View 5c6n on RCSB PDB site
Description: protein A
Class: transport protein
Keywords: protein A, TRANSPORT PROTEIN
Deposited on 2015-06-23, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BH2163 protein
    Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) [TaxId:272558]
    Gene: BH2163
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KAX3
      • conflict (39)
    Domains in SCOPe 2.07: d5c6na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c6nA (A:)
    meqkqqserlgteaipkllrslsipamigmfvmalynvvntifisyavgiegvagvtiaf
    pimmimmsmagalgiggasvisrrlgerrgeeanqvfgniltvilvlsvigfisaftllg
    palqlfgatsvtqgyatdylfpillgsiffffafaanniirsegnatfamvtmivpavln
    illdvlfifglnmgvlgasiatviaqasvtglvlryfltgkstlslhwsdlrmkgsvike
    vclvglpafvqqssaslmmiainsmllrfgsdfyvgvfglvqrimmfvmmpmmgimqamq
    pivgynygakqysrlretvmlgfkvatifsigifallmlfpeallrvftadreviqagvs
    amhilfcvtfligaqivagglyqslgkpkqalilslsrqiifliplvlilphifglsgvw
    wafpiadvlsfiltvvllyrdrnvfflktkeereldlvktass
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6nA (A:)
    qkqqserlgteaipkllrslsipamigmfvmalynvvntifisyavgiegvagvtiafpi
    mmimmsmagalgiggasvisrrlgerrgeeanqvfgniltvilvlsvigfisaftllgpa
    lqlfgatsvtqgyatdylfpillgsiffffafaanniirsegnatfamvtmivpavlnil
    ldvlfifglnmgvlgasiatviaqasvtglvlryfltgkstlslhwsdlrmkgsvikevc
    lvglpafvqqssaslmmiainsmllrfgsdfyvgvfglvqrimmfvmmpmmgimqamqpi
    vgynygakqysrlretvmlgfkvatifsigifallmlfpeallrvftadreviqagvsam
    hilfcvtfligaqivagglyqslgkpkqalilslsrqiifliplvlilphifglsgvwwa
    fpiadvlsfiltvvllyrdrnvfflk