PDB entry 5c6e

View 5c6e on RCSB PDB site
Description: Joint X-ray/neutron structure of equine cyanomet hemoglobin in R state
Class: oxygen transport
Keywords: Equine Hemoglobin, R-State, OXYGEN TRANSPORT
Deposited on 2015-06-22, released 2016-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAYNEUT
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c6ea_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c6eb_
  • Heterogens: HEM, CYN, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5c6eA (A:)
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5c6eB (B:)
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh