PDB entry 5c6c

View 5c6c on RCSB PDB site
Description: PKG II's Amino Terminal Cyclic Nucleotide Binding Domain (CNB-A) in a complex with cAMP
Class: protein binding
Keywords: Binding Sites, Cyclic AMP, Cyclic GMP, Cyclic GMP-Dependent Protein Kinase Type II, Mutagenesis, Site-Directed, Protein Binding
Deposited on 2015-06-22, released 2016-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG2, PRKGR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c6ca_
  • Chain 'B':
    Compound: cGMP-dependent protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG2, PRKGR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c6cb_
  • Heterogens: CD, CMP, CO, CA, EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c6cA (A:)
    gsnkppefsfekarvrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsy
    iikqgepgnhifvlaegrlevfqgekllssipmwttfgelailynctrtasvkaitnvkt
    waldrevfqnimrrtaqardeqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6cA (A:)
    rkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsyiikqgepgnhifvla
    egrlevfqgekllssipmwttfgelailynctrtasvkaitnvktwaldrevfqnimrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c6cB (B:)
    gsnkppefsfekarvrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsy
    iikqgepgnhifvlaegrlevfqgekllssipmwttfgelailynctrtasvkaitnvkt
    waldrevfqnimrrtaqardeqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6cB (B:)
    rvrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsyiikqgepgnhifv
    laegrlevfqgellssipmwttfgelailynctrtasvkaitnvktwaldrevfqnimr