PDB entry 5c5b

View 5c5b on RCSB PDB site
Description: Crystal Structure of Human APPL BAR-PH Heterodimer
Class: protein transport
Keywords: heterodimer, PROTEIN TRANSPORT
Deposited on 2015-06-19, released 2016-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DCC-interacting protein 13-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: APPL1, APPL, DIP13A, KIAA1428
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKG1 (4-374)
      • expression tag (3)
    Domains in SCOPe 2.07: d5c5ba1, d5c5ba2, d5c5ba3
  • Chain 'B':
    Compound: DCC-interacting protein 13-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: APPL2, DIP13B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c5bb1, d5c5bb2
  • Chain 'C':
    Compound: DCC-interacting protein 13-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: APPL1, APPL, DIP13A, KIAA1428
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKG1 (4-374)
      • expression tag (3)
    Domains in SCOPe 2.07: d5c5bc1, d5c5bc2, d5c5bc3
  • Chain 'D':
    Compound: DCC-interacting protein 13-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: APPL2, DIP13B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c5bd1, d5c5bd2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c5bA (A:)
    gshmdklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathl
    tskllkeyekqrfplggddevmsstlqqfskvidelsschavlstqladammfpitqfke
    rdlkeiltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmh
    yfcalntlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrrem
    dsdietmqqtiedlevasdplyvpdpdptkfpvnrnltrkagylnarnktglvsstwdrq
    fyftqggnlmsqargdvagglamdidncsvmavdcedrrycfqitsfdgkkssilqaesk
    kdheewictinnisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c5bA (A:)
    mdklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltsk
    llkeyekevmsstlqqfskvidelsschavlstqladammfpitqfkerdlkeiltlkev
    fqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfcalntlqykk
    kiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsdietmqqtie
    dlevasdplyvpdpdptkfpvnrnltrkagylnarnkstwdrqfyftqggnlmsqargdv
    agglamdidncsvmavdcedrrycfqitsfdgkkssilqaeskkdheewictinnisk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c5bB (B:)
    mpavdkllleealqdspqtrsllsvfeedagtltdytnqllqamqrvygaqnemclatqq
    lskqllayekqnfalgkgdeevistlhyfskvvdelnllhtelakqladtmvlpiiqfre
    kdltevstlkdlfglasnehdlsmakysrlpkkkenekvktevgkevaaarrkqhlsslq
    yycalnalqyrkqmammepmigfahgqinffkkgaemfskrmdsflssvadmvqsiqvel
    eaeaekmrvsqqellsvdesvytpdsdvaapqinrnliqkagylnlrnktglvtttwerl
    yfftqggnlmcqprgavaggliqdldncsvmavdcedrrycfqittpngksgiilqaesr
    keneewicainnisr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c5bB (B:)
    dkllleealqdspqtrsllsvfeedagtltdytnqllqamqrvygaqnemclatqqlskq
    llayekqnfalgkgdeevistlhyfskvvdelnllhtelakqladtmvlpiiqfrekdlt
    evstlkdlfglasnehdlsmakysrlpkkkenekvktevgkevaaarrkqhlsslqyyca
    lnalqyrkqmammepmigfahgqinffkkgaemfskrmdsflssvadmvqsiqveleaea
    ekmrvsqqellsvdesvytpdsdvaapqinrnliqkagylnlrnktglvtttwerlyfft
    qggnlmcqprgavaggliqdldncsvmavdcedrrycfqittpngksgiilqaesrkene
    ewicainnis
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5c5bC (C:)
    gshmdklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathl
    tskllkeyekqrfplggddevmsstlqqfskvidelsschavlstqladammfpitqfke
    rdlkeiltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmh
    yfcalntlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrrem
    dsdietmqqtiedlevasdplyvpdpdptkfpvnrnltrkagylnarnktglvsstwdrq
    fyftqggnlmsqargdvagglamdidncsvmavdcedrrycfqitsfdgkkssilqaesk
    kdheewictinnisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c5bC (C:)
    mdklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltsk
    llkeyekqevmsstlqqfskvidelsschavlstqladammfpitqfkerdlkeiltlke
    vfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfcalntlqyk
    kkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsdietmqqti
    edlevasdplyvpdpdptkfpvnrnltrkagylnarnstwdrqfyftqggnlmsqargdv
    agglamdidncsvmavdcedrrycfqitsfdgkkssilqaeskkdheewictinnisk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5c5bD (D:)
    mpavdkllleealqdspqtrsllsvfeedagtltdytnqllqamqrvygaqnemclatqq
    lskqllayekqnfalgkgdeevistlhyfskvvdelnllhtelakqladtmvlpiiqfre
    kdltevstlkdlfglasnehdlsmakysrlpkkkenekvktevgkevaaarrkqhlsslq
    yycalnalqyrkqmammepmigfahgqinffkkgaemfskrmdsflssvadmvqsiqvel
    eaeaekmrvsqqellsvdesvytpdsdvaapqinrnliqkagylnlrnktglvtttwerl
    yfftqggnlmcqprgavaggliqdldncsvmavdcedrrycfqittpngksgiilqaesr
    keneewicainnisr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c5bD (D:)
    dkllleealqdspqtrsllsvfeedagtltdytnqllqamqrvygaqnemclatqqlskq
    llayekqnfalgkgdeevistlhyfskvvdelnllhtelakqladtmvlpiiqfrekdlt
    evstlkdlfglasnehdlsmakysrlpkkkenekvktevgkevaaarrkqhlsslqyyca
    lnalqyrkqmammepmigfahgqinffkkgaemfskrmdsflssvadmvqsiqveleaea
    ekmrvsqqellsvdesvytpdsdvaapqinrnliqkagylnlrnktglvtttwerlyfft
    qggnlmcqprgavaggliqdldncsvmavdcedrrycfqittpngksgiilqaesrkene
    ewicainnisr