PDB entry 5c4q

View 5c4q on RCSB PDB site
Description: Crystal Structure Analysis of bromodomain from Leishmania donovani complexed with bromosporine
Class: transcription
Keywords: Structural Genomics Consortium, SGC, Bromodomain, Bromosporine, Leishmania donovani, Transcription
Deposited on 2015-06-18, released 2015-07-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain
    Species: Leishmania donovani (strain BPK282A1) [TaxId:981087]
    Gene: LDBPK_363130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c4qa_
  • Chain 'B':
    Compound: Bromodomain
    Species: Leishmania donovani (strain BPK282A1) [TaxId:981087]
    Gene: LDBPK_363130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5c4qb_
  • Heterogens: BMF, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c4qA (A:)
    mdvskrpreefhkeqclsfvkklwaadtlamfhypvsatevpgyydvvdtpmdlstirkn
    ieqgkyrtdtevendvvlmlsnaldfnekgsqwhdlakqlkkryltlaqesglsfdadqa
    fiptk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c4qA (A:)
    mdvskrpreefhkeqclsfvkklwaadtlamfhypvsatevpgyydvvdtpmdlstirkn
    ieqgkyrtdtevendvvlmlsnaldfnekgsqwhdlakqlkkryltlaqesglsfdad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c4qB (B:)
    mdvskrpreefhkeqclsfvkklwaadtlamfhypvsatevpgyydvvdtpmdlstirkn
    ieqgkyrtdtevendvvlmlsnaldfnekgsqwhdlakqlkkryltlaqesglsfdadqa
    fiptk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c4qB (B:)
    dvskrpreefhkeqclsfvkklwaadtlamfhypvsatevpgyydvvdtpmdlstirkni
    eqgkyrtdtevendvvlmlsnaldfnekgsqwhdlakqlkkryltlaqesglsf