PDB entry 5c46

View 5c46 on RCSB PDB site
Description: Crystal structure of an engineered construct of phosphatidylinositol 4 kinase III beta in complex with GTP gamma S loaded Rab11
Class: Transferase/Signaling Protein
Keywords: Protein-protein complex, lipid kinase, GTPase complex, Transferase-Signaling Protein complex
Deposited on 2015-06-17, released 2016-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: phosphatidylinositol 4-kinase beta
    Species: Homo sapiens [TaxId:9606]
    Gene: PI4KB, PIK4CB
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (72)
    Domains in SCOPe 2.06: d5c46f_
  • Heterogens: SO4, GSP, MG, HOH

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5c46F (F:)
    gshmgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdg
    ktikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsni
    vimlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    qkqmsdrrendmspsnnvvpihvppttenkpkvqccqni
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c46F (F:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkq