PDB entry 5c3l
View 5c3l on RCSB PDB site
Description: Structure of the metazoan Nup62.Nup58.Nup54 nucleoporin complex.
Class: transport protein
Keywords: nucleoporin, heterotrimeric coiled coils, kink containing coiled-coils, six helix-bundle, transport protein
Deposited on
2015-06-17, released
2015-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated
2015-10-14, with a file datestamp of
2015-10-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Nup54
Species: Xenopus laevis [TaxId:8355]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Nucleoporin Nup58
Species: Xenopus laevis [TaxId:8355]
Gene: MGC84997
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Nucleoporin Nup62
Species: Xenopus laevis [TaxId:8355]
Gene: nup62, IL4I1
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Nanobody Nb15
Species: Camelus dromedarius [TaxId:9838]
Gene: Immunoglobulin G
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5c3ld1, d5c3ld2 - Chain 'H':
Compound: Part of Nup54 N-terminus with weak electron density, built as poly-alanine.
Species: Xenopus laevis [TaxId:8355]
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>5c3lD (D:)
agtasqvqlqesggglvqpggslrlscaasgftfsnyamswvrqapgkglevvsdigsgg
drityadsvkgrftisrdnakntlylqmnslkpedtavyycanqygrgpgtqvtvssgs
Sequence, based on observed residues (ATOM records): (download)
>5c3lD (D:)
qvqlqesggglvqpggslrlscaasgftfsnyamswvrqapgkglevvsdigsggdrity
adsvkgrftisrdnakntlylqmnslkpedtavyycanqygrgpgtqvtvss
- Chain 'H':
No sequence available.