PDB entry 5c3l

View 5c3l on RCSB PDB site
Description: Structure of the metazoan Nup62.Nup58.Nup54 nucleoporin complex.
Class: transport protein
Keywords: nucleoporin, heterotrimeric coiled coils, kink containing coiled-coils, six helix-bundle, transport protein
Deposited on 2015-06-17, released 2015-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nup54
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nucleoporin Nup58
    Species: Xenopus laevis [TaxId:8355]
    Gene: MGC84997
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nucleoporin Nup62
    Species: Xenopus laevis [TaxId:8355]
    Gene: nup62, IL4I1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nanobody Nb15
    Species: Camelus dromedarius [TaxId:9838]
    Gene: Immunoglobulin G
    Database cross-references and differences (RAF-indexed):
    • PDB 5C3L
    Domains in SCOPe 2.08: d5c3ld1, d5c3ld2
  • Chain 'H':
    Compound: Part of Nup54 N-terminus with weak electron density, built as poly-alanine.
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • PDB 5C3L (0-13)

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5c3lD (D:)
    agtasqvqlqesggglvqpggslrlscaasgftfsnyamswvrqapgkglevvsdigsgg
    drityadsvkgrftisrdnakntlylqmnslkpedtavyycanqygrgpgtqvtvssgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c3lD (D:)
    qvqlqesggglvqpggslrlscaasgftfsnyamswvrqapgkglevvsdigsggdrity
    adsvkgrftisrdnakntlylqmnslkpedtavyycanqygrgpgtqvtvss
    

  • Chain 'H':
    No sequence available.