PDB entry 5c3j

View 5c3j on RCSB PDB site
Description: Crystal structure of Mitochondrial rhodoquinol-fumarate reductase from Ascaris suum with Ubiquinone-1
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: rhodoquinol-fumarate reductase, Complex II, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2015-06-17, released 2016-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c3jb1, d5c3jb2
  • Chain 'C':
    Compound: Cytochrome b-large subunit
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c3jf1, d5c3jf2
  • Chain 'G':
    Compound: Cytochrome b-large subunit
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MLI, FAD, FES, SF4, F3S, HEM, UQ1, EPH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c3jB (B:)
    mlrgstsvcrslelvtqaaryasaataaaptgkriktfeiyrfnpeepgakpklqkfdvd
    ldkcgtmvldalikiknevdptltfrrscregicgscamniagentlacicnidqntskt
    tkiyplphmfvikdlvpdmnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldgly
    ecilcaccsascpsywwnadkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkch
    timnctktcpkhlnparaigeikmlltkmktkpaplptpanf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c3jB (B:)
    kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
    icgscamniagentlacicnidqntskttkiyplphmfvikdlvpdmnlfyaqyasiqpw
    lqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwnadkylgpavlmqay
    rwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnparaigeikmlltkmktk
    paplptpanf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5c3jF (F:)
    mlrgstsvcrslelvtqaaryasaataaaptgkriktfeiyrfnpeepgakpklqkfdvd
    ldkcgtmvldalikiknevdptltfrrscregicgscamniagentlacicnidqntskt
    tkiyplphmfvikdlvpdmnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldgly
    ecilcaccsascpsywwnadkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkch
    timnctktcpkhlnparaigeikmlltkmktkpaplptpanf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c3jF (F:)
    kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
    icgscamniagentlacicnidqntskttkiyplphmfvikdlvpdmnlfyaqyasiqpw
    lqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwnadkylgpavlmqay
    rwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnparaigeikmlltkmktk
    paplptpanf
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.