PDB entry 5c31

View 5c31 on RCSB PDB site
Description: Constitutively active Sin recombinase catalytic domain reveals two rotational intermediates
Class: DNA binding protein
Keywords: Serine recombinase, Site specific recombinase, Conformational flexibility, DNA BINDING PROTEIN
Deposited on 2015-06-16, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31a_
  • Chain 'B':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31b_
  • Chain 'C':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31c_
  • Chain 'D':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31d_
  • Chain 'E':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31e_
  • Chain 'F':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31f_
  • Chain 'G':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31g_
  • Chain 'H':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31h_
  • Chain 'I':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31i_
  • Chain 'J':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31j_
  • Chain 'K':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31k_
  • Chain 'L':
    Compound: Sin, putative plasmid resolvase dimer
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: Sin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20384 (0-End)
      • engineered mutation (53)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d5c31l_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c31A (A:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31A (A:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqern
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c31B (B:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31B (B:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqern
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5c31C (C:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31C (C:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5c31D (D:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31D (D:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqer
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5c31E (E:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31E (E:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqer
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5c31F (F:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31F (F:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqer
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5c31G (G:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31G (G:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmgnplldkfmkdlviqilamvseqe
    rn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5c31H (H:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31H (H:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqer
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5c31I (I:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31I (I:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqern
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5c31J (J:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31J (J:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqer
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5c31K (K:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31K (K:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqern
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5c31L (L:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqernes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c31L (L:)
    miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
    vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
    seqer