PDB entry 5c1s

View 5c1s on RCSB PDB site
Description: Crystal structure of the GDP-bound fast hydrolyzing mutant (V71A/K73Q) of EhRabX3 from Entamoeba histolytica
Class: hydrolase
Keywords: P-loop containing nucleotide triphosphate hydrolases fold, Tandem GTPase, HYDROLASE
Deposited on 2015-06-15, released 2016-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small GTPase EhRabX3
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhRabX3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NT25
      • engineered mutation (112)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d5c1sa1, d5c1sa2
  • Chain 'B':
    Compound: Small GTPase EhRabX3
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhRabX3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NT25
      • engineered mutation (112)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d5c1sb1, d5c1sb2
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c1sA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmamirpahmirpahkslrtrsqiigk
    keirllvvgssgvgkttlcdcffeshqsqgeetrekhvqidndfirisisdiagqqsfya
    cdnpydgydailvmyditelksftdlktmwlpdiflycnidtqiiiignkkdqeidriit
    rkeaeqfaqdrlcqfyeistkddscqllfdcisrdflqcdikirmlmvgdqnvgkttfir
    kfalqdptghdfmnaittrfemekikyeiimidwgfynkllqtnpaisrtieailivydi
    tneesfqnihrkyyplinnkfsdvagvivgyktdleaqrkitmgdaltladwlgykyvem
    sskdtedhssiikalahsirinrlkieqsye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c1sA (A:)
    keirllvvgssgvgkttlcdcffesisisdiagqqsfyacdnpydgydailvmyditelk
    sftdlktmwlpdiflycnidtqiiiignkkdqeidriitrkeaeqfaqdrlcqfyeistk
    ddscqllfdcisrdflqcdikirmlmvgdqnvgkttkfalqdptghdfmnaittrfeeki
    kyeiimidwgfynkllqtnpaisrtieailivyditneesfqnihrkyyplinnkfsdvv
    gyktdleaqrkitmgdaltladwlgykyvemsskdtedhssiikalah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c1sB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmamirpahmirpahkslrtrsqiigk
    keirllvvgssgvgkttlcdcffeshqsqgeetrekhvqidndfirisisdiagqqsfya
    cdnpydgydailvmyditelksftdlktmwlpdiflycnidtqiiiignkkdqeidriit
    rkeaeqfaqdrlcqfyeistkddscqllfdcisrdflqcdikirmlmvgdqnvgkttfir
    kfalqdptghdfmnaittrfemekikyeiimidwgfynkllqtnpaisrtieailivydi
    tneesfqnihrkyyplinnkfsdvagvivgyktdleaqrkitmgdaltladwlgykyvem
    sskdtedhssiikalahsirinrlkieqsye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c1sB (B:)
    rllvvgssgvgkttlcdcffeshdndfirisisdiagqqsfyacdnpydailvmyditel
    ksftdlktmwlpdiflycnidtqiiiignkkdqeidriitrkeaeqfaqdrlcqfyeist
    kddscqllfdcisrdflqcdikirmlmvggkttfirtghdfmnaittrfemekyeiimid
    wgfynkllqtnpaisrtieailivyditneesfqnihrkyyplinnkfsdvagvivgykt
    dleaqrkitmgdaltladwlgykyvemsskdtedhssiikala