PDB entry 5c0r

View 5c0r on RCSB PDB site
Description: Crystal Structure of a Generation 3 Influenza Hemagglutinin Stabilized Stem Complexed with the Broadly Neutralizing Antibody C179
Class: viral protein/immune system
Keywords: Hemagglutinin, immunogen, trimer, complex, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2015-06-12, released 2015-09-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-02, with a file datestamp of 2015-08-28.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin, Envelope glycoprotein, Fibritin fusion protein
    Species: Influenza A virus, Human immunodeficiency virus type 1 group M subtype B, Enterobacteria phage T4 [TaxId:381512, 11706, 10655]
    Gene: HA, env, wac
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WG00 (0-31)
      • linker (32-34)
    • Uniprot Q6WG00 (35-109)
      • conflict (46)
      • conflict (46)
      • conflict (46)
      • conflict (46)
      • linker (110-111)
    • Uniprot P04578 (112-138)
      • conflict (125)
      • conflict (127)
      • linker (139-140)
    • Uniprot P04578 (Start-176)
    • Uniprot Q6WG00 (177-End)
    • Uniprot D9IEJ2 (262-End)
  • Chain 'H':
    Compound: C179 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5C0R (0-End)
  • Chain 'L':
    Compound: C179 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5C0R (0-213)
    Domains in SCOPe 2.05: d5c0rl1, d5c0rl2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c0rL (L:)
    diqmtqspasqsaslgesvtitclasqtigtwlawyqqkpgkspqlliyaatsladgvps
    rfsgsgsgtkfsfkisslqaedfvsyycqqlystpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec