PDB entry 5c05

View 5c05 on RCSB PDB site
Description: Crystal Structure of Gamma-terpinene Synthase from Thymus vulgaris
Class: biosynthetic protein
Keywords: terpenoid synthesis, gamma-terpinene, plant, terpene, plant protein, biosynthetic protein
Deposited on 2015-06-12, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative gamma-terpinene synthase
    Species: Thymus vulgaris [TaxId:49992]
    Database cross-references and differences (RAF-indexed):
    • PDB 5C05 (Start-558)
    Domains in SCOPe 2.07: d5c05a1, d5c05a2
  • Chain 'B':
    Compound: Putative gamma-terpinene synthase
    Species: Thymus vulgaris [TaxId:49992]
    Database cross-references and differences (RAF-indexed):
    • PDB 5C05 (Start-558)
    Domains in SCOPe 2.07: d5c05b1, d5c05b2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c05A (A:)
    mhhhhhhitslykkagsmrrsgnyqapvwnndfiqsfstdkykdekflkkkeeliaqvkv
    llntkmeavkqleliedlrnlgltyyfedefkkiltsiynehkgfkneqvgdlyftslaf
    rllrlhgfdvsedvfnffknedgsdfkaslgentkdvlelyeasflirvgevtleqarvf
    stkilekkveegikdekllawiqhslalplhwriqrlearwfldaykarkdmnpiiyelg
    kidfhiiqetqlqevqevsqwwtntnlaeklpfvrdrivecyfwalglfepheygyqrkm
    aaiiitfvtiiddvydvydtldelqlftdairkwdvesistlpyymqvcylavftyasel
    aydilkdqgfnsisylqrswlslvegffqeakwyyagytptlaeylenakvsissptiis
    qvyftlpnstertvvenvfgyhnilylsgmilrladdlgttqfelkrgdvqkaiqcymnd
    nnateeegtehvkyllreawqemnsamadpdcplsedlvfaaanlgrtsqfiyldgdghg
    vqhseihnqmgglifepyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c05A (A:)
    vwnndfiqsfstdkykdekflkkkeeliaqvkvllntkmeavkqleliedlrnlgltyyf
    edefkkiltsiynehkgfkneqvgdlyftslafrllrlhgfdvsedvfnffknedgsdfk
    aslgentkdvlelyeasflirvgevtleqarvfstkilekkveegikdekllawiqhsla
    lplhwriqrlearwfldaykarkdmnpiiyelgkidfhiiqetqlqevqevsqwwtntnl
    aeklpfvrdrivecyfwalglfepheygyqrkmaaiiitfvtiiddvydvydtldelqlf
    tdairkwdvesistlpyymqvcylavftyaselaydilkdqgfnsisylqrswlslvegf
    fqeakwyyagytptlaeylenakvsissptiisqvyftlpnstertvvenvfgyhnilyl
    sgmilrladdlgttqkaiqcymndnnateeegtehvkyllreawqemnsamadpdcplse
    dlvfaaanlgrtsqfiyldeihnqmgglifepyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c05B (B:)
    mhhhhhhitslykkagsmrrsgnyqapvwnndfiqsfstdkykdekflkkkeeliaqvkv
    llntkmeavkqleliedlrnlgltyyfedefkkiltsiynehkgfkneqvgdlyftslaf
    rllrlhgfdvsedvfnffknedgsdfkaslgentkdvlelyeasflirvgevtleqarvf
    stkilekkveegikdekllawiqhslalplhwriqrlearwfldaykarkdmnpiiyelg
    kidfhiiqetqlqevqevsqwwtntnlaeklpfvrdrivecyfwalglfepheygyqrkm
    aaiiitfvtiiddvydvydtldelqlftdairkwdvesistlpyymqvcylavftyasel
    aydilkdqgfnsisylqrswlslvegffqeakwyyagytptlaeylenakvsissptiis
    qvyftlpnstertvvenvfgyhnilylsgmilrladdlgttqfelkrgdvqkaiqcymnd
    nnateeegtehvkyllreawqemnsamadpdcplsedlvfaaanlgrtsqfiyldgdghg
    vqhseihnqmgglifepyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c05B (B:)
    vwnndfiqsfstdkykdekflkkkeeliaqvkvllntkmeavkqleliedlrnlgltyyf
    edefkkiltsiynehkgfkneqvgdlyftslafrllrlhgfdvsedvfnffknedgsdfk
    aslgentkdvlelyeasflirvgevtleqarvfstkilekkveegikdekllawiqhsla
    lplhwriqrlearwfldaykarkdmnpiiyelgkidfhiiqetqlqevqevsqwwtntnl
    aeklpfvrdrivecyfwalglfepheygyqrkmaaiiitfvtiiddvydvydtldelqlf
    tdairkwdvesistlpyymqvcylavftyaselaydilkdqgfnsisylqrswlslvegf
    fqeakwyyagytptlaeylenakvsissptiisqvyftlpnstertvvenvfgyhnilyl
    sgmilrladdlgttqfelkrgdvqkaiqcymndnnateeegtehvkyllreawqemnsam
    adpdcplsedlvfaaanlgrtsqfiyldihnqmgglifepyv