PDB entry 5bzw

View 5bzw on RCSB PDB site
Description: Crystal Structure of PCDN-27B, an antibody from the PCDN family of HIV-1 antibodies
Class: immune system
Keywords: HIV, Antibody, Fab, IMMUNE SYSTEM
Deposited on 2015-06-11, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2B3 HIV Antibody light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5BZW (0-End)
    Domains in SCOPe 2.07: d5bzwa1, d5bzwa2
  • Chain 'B':
    Compound: 2B3 HIV Antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5BZW (0-End)
  • Heterogens: SO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bzwA (A:)
    eivltqspgtlslspgeratlscrasqsvsaknlawyqqkpgqtprllmygvslrntgvp
    drfsgsgsgtdftltisrlepedsavyfcqqygtsptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bzwA (A:)
    eivltqspgtlslspgeratlscrasqsvsaknlawyqqkpgqtprllmygvslrntgvp
    drfsgsgsgtdftltisrlepedsavyfcqqygtsptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.