PDB entry 5byw

View 5byw on RCSB PDB site
Description: Crystal structure of engineered trifunctional CtCEL5E
Class: hydrolase
Keywords: Ctcel5E, cellulose, HYDROLASE
Deposited on 2015-06-11, released 2016-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase h
    Species: Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) [TaxId:203119]
    Gene: celH, Cthe_1472
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16218
      • engineered mutation (266)
      • engineered mutation (272)
      • insertion (277-287)
      • engineered mutation (288-292)
    Domains in SCOPe 2.06: d5bywa_
  • Chain 'B':
    Compound: endoglucanase h
    Species: Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) [TaxId:203119]
    Gene: celH, Cthe_1472
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16218
      • engineered mutation (266)
      • engineered mutation (272)
      • insertion (277-287)
      • engineered mutation (288-292)
    Domains in SCOPe 2.06: d5bywb_
  • Chain 'C':
    Compound: endoglucanase h
    Species: Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) [TaxId:203119]
    Gene: celH, Cthe_1472
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16218
      • engineered mutation (266)
      • engineered mutation (272)
      • insertion (277-287)
      • engineered mutation (288-292)
    Domains in SCOPe 2.06: d5bywc_
  • Chain 'D':
    Compound: endoglucanase h
    Species: Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) [TaxId:203119]
    Gene: celH, Cthe_1472
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16218
      • engineered mutation (266)
      • engineered mutation (272)
      • insertion (277-287)
      • engineered mutation (288-292)
    Domains in SCOPe 2.06: d5bywd_
  • Chain 'E':
    Compound: endoglucanase h
    Species: Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) [TaxId:203119]
    Gene: celH, Cthe_1472
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16218
      • engineered mutation (266)
      • engineered mutation (272)
      • insertion (277-287)
      • engineered mutation (288-292)
    Domains in SCOPe 2.06: d5bywe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bywA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgriegrefsspealaayreaigagssnptp
    tptwtstppssspkavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagy
    knvripvrwdnhtmrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngn
    ierfekiweqiaerfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptrivi
    igggywnsyntlvnikipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedm
    dtvvrvfdfvkswsdrnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdn
    gvfgsldndmaiynrdtrtfdteilnalfnpgtypsyspkpsptprptkppvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bywA (A:)
    avdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnhtm
    rtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqiaer
    fknksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntlvn
    ikipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedmdtvvrvfdfvksws
    drnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndmaiyn
    rdtrtfdteilnalfnpgt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bywB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgriegrefsspealaayreaigagssnptp
    tptwtstppssspkavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagy
    knvripvrwdnhtmrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngn
    ierfekiweqiaerfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptrivi
    igggywnsyntlvnikipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedm
    dtvvrvfdfvkswsdrnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdn
    gvfgsldndmaiynrdtrtfdteilnalfnpgtypsyspkpsptprptkppvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bywB (B:)
    vdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnhtmr
    typytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqiaerf
    knksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntlvni
    kipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedmdtvvrvfdfvkswsd
    rnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndmaiynr
    dtrtfdteilnalfnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bywC (C:)
    mgsshhhhhhssglvprgshmasmtggqqmgriegrefsspealaayreaigagssnptp
    tptwtstppssspkavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagy
    knvripvrwdnhtmrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngn
    ierfekiweqiaerfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptrivi
    igggywnsyntlvnikipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedm
    dtvvrvfdfvkswsdrnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdn
    gvfgsldndmaiynrdtrtfdteilnalfnpgtypsyspkpsptprptkppvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bywC (C:)
    vdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnhtmr
    typytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqiaerf
    knksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntlvni
    kipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedmdtvvrvfdfvkswsd
    rnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndmaiynr
    dtrtfdteilnalfnpgt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bywD (D:)
    mgsshhhhhhssglvprgshmasmtggqqmgriegrefsspealaayreaigagssnptp
    tptwtstppssspkavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagy
    knvripvrwdnhtmrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngn
    ierfekiweqiaerfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptrivi
    igggywnsyntlvnikipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedm
    dtvvrvfdfvkswsdrnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdn
    gvfgsldndmaiynrdtrtfdteilnalfnpgtypsyspkpsptprptkppvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bywD (D:)
    kavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnht
    mrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqiae
    rfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntlv
    nikipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedmdtvvrvfdfvksw
    sdrnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndmaiy
    nrdtrtfdteilnalfnpgt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5bywE (E:)
    mgsshhhhhhssglvprgshmasmtggqqmgriegrefsspealaayreaigagssnptp
    tptwtstppssspkavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagy
    knvripvrwdnhtmrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngn
    ierfekiweqiaerfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptrivi
    igggywnsyntlvnikipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedm
    dtvvrvfdfvkswsdrnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdn
    gvfgsldndmaiynrdtrtfdteilnalfnpgtypsyspkpsptprptkppvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bywE (E:)
    avdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnhtm
    rtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqiaer
    fknksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntlvn
    ikipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedmdtvvrvfdfvksws
    drnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndmaiyn
    rdtrtfdteilnalfnpgtypsy